KEGG   Delphinapterus leucas (beluga whale): 111169381
Entry
111169381         CDS       T05885                                 

Gene name
MAD1L1
Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD1 isoform X1
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04114  Oocyte meiosis
dle04914  Progesterone-mediated oocyte maturation
dle05166  Human T-cell leukemia virus 1 infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111169381 (MAD1L1)
   04114 Oocyte meiosis
    111169381 (MAD1L1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    111169381 (MAD1L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111169381 (MAD1L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111169381 (MAD1L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111169381 (MAD1L1)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     111169381 (MAD1L1)
SSDB
Motif
Pfam: MAD TSC22
Other DBs
NCBI-GeneID: 111169381
NCBI-ProteinID: XP_022419247
UniProt: A0A2Y9MJP1
LinkDB
Position
Unknown
AA seq 717 aa
MEDLGENTTVLSTLRSLNNFISQRVEGGSGLDVSISAQGSLQMQYQQSMQLEERAEQIRS
RSHLIQVEREKTQMELSHKRARVELERAASASARSYEREVDRNQELLTRIRQLQEREAEA
EGKMKEQLQRYRVCQQSLDAANKRLRDQEDGLAEAGETVSVLKGRLSDLQWSVMNQEMQV
KRLESERQELKEQLELQHRKWQEANQKVQELQASQEARGDQEQRIKDLEQKLTLQEQDAA
IVKNMRSELARLPTVERELRQLREENACLREMRDTNGLLREELEGLQRRLGRQEKMQETL
VDLELEKERLLTKLQSWERLDQTTGLSIRTPEDLSRFIVELQQRELTLKDRNSSITSSAR
GLEKARLQLQEEVCQLSSQLLEERKKREMHEALARRLQKRVLLLTKERDGMRAILGSYDS
ELTPAEYSPQLTRRMREAEDMVQKVHAHSSEMEAQLSQALEELGGQKQRADMLEMELKML
KSQAGPAEQSFLFSREEVSSLRLKVEELEAERSRLEEEKKVLETQLERLTLQGDYDQSRA
KVLHLSLNPAGAARQRLHEDRQRLREECARLRELVHALEAGGAVPPDLEATAGLPSSREV
AELKKQVESAELKNQRLKEVFQTKIQEFRKVCYTLTGYQVDITTENQYRLTSMYAEHKTD
CLIFKAAGPSGTKMQLLETEFSRTVQELIELHLLRQDSIPAFLSALTLDLFSRQTVA
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggaagacctgggggaaaacaccaccgtcctatccaccctgaggtctttgaacaatttc
atttctcagcgagtggaggggggatctggactggatgtttccatctctgcccaaggttct
ctgcagatgcagtaccaacaaagcatgcagctggaggagcgagcagagcagatccgttcc
aggtcccacctcatccaggtggagcgggagaagacgcagatggagctgagtcacaagagg
gcccgcgtggaactggagcgggcagccagcgccagtgccaggagctacgagcgcgaggtg
gaccgcaaccaggagctcctgacgcgcattcggcagcttcaggagcgggaagccgaggcg
gaggggaagatgaaggagcagctgcagcgctacagggtttgccagcagagcctggatgcg
gccaacaagaggctgcgggaccaggaggacggcctggccgaagccggcgagaccgtcagt
gtgctgaaggggaggctctcggacctgcagtggagcgtcatgaaccaggagatgcaggtg
aaacgcctggagtctgagaggcaggagctgaaggagcagctggagctgcagcacaggaaa
tggcaggaagctaaccagaaggttcaggagctccaggccagccaagaagcacggggggac
caagagcagaggattaaggatttggagcagaagctgaccctgcaggagcaggatgctgca
atcgtgaagaatatgaggtctgagctggcgcggctgcccacggtggagagggagctgcgg
cagctgcgggaggagaacgcctgcctgcgggagatgcgggacaccaatgggctgctccgg
gaggagctggaggggctgcagcggaggctggggcggcaggagaagatgcaggagaccctg
gtcgacctggagctggagaaggagaggctgctcacgaaactgcagagctgggagaggctg
gaccagaccacgggcttgagcatcaggaccccagaggacctgtccaggttcatcgtggag
ctgcagcagcgcgagctcaccctcaaggacaggaacagctccatcaccagcagtgcccgg
gggctggagaaggccaggctgcagctccaggaggaggtctgccagctcagcagccagctg
ctggaggagaggaagaagcgggagatgcacgaggccctggcccggcggctgcagaagcgc
gtcctgctgctgacgaaggagcgggacggcatgcgcgccatcctggggtcctacgacagt
gagctgaccccggccgagtactcgccccagctgacccgccgcatgcgtgaggccgaggac
atggtgcagaaggtgcatgcgcacagctcagagatggaggctcagctgtcacaggccctg
gaggagctgggaggccagaaacaaagagccgacatgctggagatggagctgaagatgctg
aagtcccaggcaggcccggccgagcagagcttcttgttctccagggaggaggtgagctcg
ctcaggttgaaggttgaggagctggaggcggagcggagccgtctggaggaagagaagaag
gtgctggagacacagctggagcggctcaccctgcagggggactacgaccagagcagagcc
aaggtgctgcacctgagcctgaacccagccggcgcggcgaggcagcggctccacgaggac
cggcagcggctgcgtgaggagtgcgcgcggctgcgggagctggtccacgccttggaggcc
ggcggcgccgtcccccccgacctggaggccaccgcggggctgccctcatccagggaggtg
gcagagctgaagaagcaggtggagagtgcggagctgaagaaccagaggctgaaggaggtc
ttccagaccaagatccaggagttccggaaggtgtgctacacactgacgggctaccaggtg
gacatcaccacagagaaccagtaccggctgacctccatgtacgccgagcacaagaccgac
tgcctcatcttcaaggccgcgggaccctcgggcacgaagatgcaactgctggagacagag
ttctcccggacggtgcaggagctcatcgagctgcacctgctgcggcaggacagcatcccc
gccttcctcagcgccctcacccttgacctcttcagccgccagaccgtggcctag

DBGET integrated database retrieval system