KEGG   Delphinapterus leucas (beluga whale): 111169438
Entry
111169438         CDS       T05885                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04015  Rap1 signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04510  Focal adhesion
dle04520  Adherens junction
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04670  Leukocyte transendothelial migration
dle04916  Melanogenesis
dle04919  Thyroid hormone signaling pathway
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05100  Bacterial invasion of epithelial cells
dle05132  Salmonella infection
dle05160  Hepatitis C
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05210  Colorectal cancer
dle05213  Endometrial cancer
dle05215  Prostate cancer
dle05216  Thyroid cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05412  Arrhythmogenic right ventricular cardiomyopathy
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111169438 (CTNNB1)
   04310 Wnt signaling pathway
    111169438 (CTNNB1)
   04390 Hippo signaling pathway
    111169438 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111169438 (CTNNB1)
   04520 Adherens junction
    111169438 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    111169438 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    111169438 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111169438 (CTNNB1)
   04916 Melanogenesis
    111169438 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111169438 (CTNNB1)
   05205 Proteoglycans in cancer
    111169438 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111169438 (CTNNB1)
   05225 Hepatocellular carcinoma
    111169438 (CTNNB1)
   05226 Gastric cancer
    111169438 (CTNNB1)
   05216 Thyroid cancer
    111169438 (CTNNB1)
   05217 Basal cell carcinoma
    111169438 (CTNNB1)
   05215 Prostate cancer
    111169438 (CTNNB1)
   05213 Endometrial cancer
    111169438 (CTNNB1)
   05224 Breast cancer
    111169438 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111169438 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    111169438 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111169438 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111169438 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111169438 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111169438 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    111169438 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111169438 (CTNNB1)
   05163 Human cytomegalovirus infection
    111169438 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111169438 (CTNNB1)
   05165 Human papillomavirus infection
    111169438 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 111169438
NCBI-ProteinID: XP_022419346
UniProt: A0A2Y9MAY9
LinkDB
Position
Unknown
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctacccaagctgacttgatggagctggacatggccatggagccagacagaaaagca
gctgttagtcactggcagcaacaatcttacctggactctggaatccattctggtgccact
accacagctccttctctgagtggtaaaggcaatcctgaggaagaggatgtggataccacc
caagtcctgtatgagtgggagcagggattttctcagtccttcactcaagaacaagtagct
gatatcgatggacagtatgcaatgactcgagctcagagggtacgagctgctatgttccct
gagacattagatgagggcatgcagatcccatctacacagtttgatgccgctcatcccact
aatgtccagcgtctggctgaaccatcacagatgctgaaacatgcagttgtaaatttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaattgacaaaactgcta
aacgatgaagaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgctattgtacgc
accatgcagaatacaaatgatgtggaaacggctcgctgtactgctgggaccttacacaat
ctttcccatcatcgtgagggcttgctggccatctttaagtctgggggcattcctgccctg
gtgaagatgcttggttcaccagtggattctgtattgttttatgccattacaactctccac
aaccttttattgcatcaggaaggagctaaaatggcagtgcgtttagctggcgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacaacagactgc
cttcagattttagcttatggcaatcaagaaagcaagctgatcattttggctagtggtgga
cctcaagctttagtgaatataatgaggacctacacctatgagaaactactgtggaccaca
agcagagtactgaaggtgctgtctgtctgctctagtaataagccggctattgtagaagct
ggtggaatgcaagctttaggacttcacctgacagatccaagtcaacgtcttgttcagaat
tgtctttggactctgaggaatctttcagatgctgcaactaaacaggaagggatggagggt
cttcttgggacccttgttcagcttctgggctcagatgatataaatgtggtcacctgcgca
gctggaattctttctaatctcacttgcaataattacaagaacaagatgatggtgtgccaa
gtgggtggtatagaggctcttgtgcgtactgtccttcgtgctggtgacagggaggatatc
actgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaggaagctgagatg
gcccagaatgctgttcgccttcactatggactgccagttgtggttaaactcctacatcca
ccatcccattggcctctgatcaaggctaccgttggattgattcgaaatcttgccctttgt
cccgcaaatcacgcacctttgcgtgagcagggtgccattccacgactagttcagttgctg
gttcgtgcacatcaggatacccagcgccgtacatctatgggtggaacacagcagcagttt
gtggagggggtccgcatggaagaaatagttgaaggttgtactggagcccttcacatccta
gctcgggatgttcacaaccgaattgttatcagaggcctaaataccattccattgtttgtg
cagctgctttattctcccattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaggctgcagaagctattgaagctgagggagccacagctcctctg
acagaattacttcattctaggaatgaaggtgtggcaacatatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaggattataagaaacggctttcggttgagctgaccagt
tctctcttcagaacggaaccaatggcttggaatgagactgctgatcttggacttgatatc
ggtgcccagggagaaccccttggatatcgccaggatgatcccagctatcgttcttttcac
tctggtggatacggccaggatgccttgggtatggaccccatgatggagcatgagatgggc
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctgcctccaggtgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system