KEGG   Delphinapterus leucas (beluga whale): 111169692
Entry
111169692         CDS       T05885                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04020  Calcium signaling pathway
dle04072  Phospholipase D signaling pathway
dle04144  Endocytosis
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04540  Gap junction
dle04630  JAK-STAT signaling pathway
dle04810  Regulation of actin cytoskeleton
dle05163  Human cytomegalovirus infection
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111169692 (PDGFRA)
   04014 Ras signaling pathway
    111169692 (PDGFRA)
   04015 Rap1 signaling pathway
    111169692 (PDGFRA)
   04630 JAK-STAT signaling pathway
    111169692 (PDGFRA)
   04020 Calcium signaling pathway
    111169692 (PDGFRA)
   04072 Phospholipase D signaling pathway
    111169692 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    111169692 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111169692 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111169692 (PDGFRA)
   04540 Gap junction
    111169692 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111169692 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111169692 (PDGFRA)
   05206 MicroRNAs in cancer
    111169692 (PDGFRA)
   05230 Central carbon metabolism in cancer
    111169692 (PDGFRA)
   05231 Choline metabolism in cancer
    111169692 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    111169692 (PDGFRA)
   05218 Melanoma
    111169692 (PDGFRA)
   05215 Prostate cancer
    111169692 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111169692 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111169692 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111169692 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dle04090]
    111169692 (PDGFRA)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111169692 (PDGFRA)
Protein kinases [BR:dle01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   111169692 (PDGFRA)
CD molecules [BR:dle04090]
 Proteins
  111169692 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE LAT Kinase-like
Other DBs
NCBI-GeneID: 111169692
NCBI-ProteinID: XP_022419778
UniProt: A0A2Y9MC65
LinkDB
Position
Unknown
AA seq 1089 aa
MGTSHWALLVLGCLVTGPSLILCQLSLPSILPSENERVVQLNSSFSLRCFGESEVSWQYP
MSEEENPNVEIRDEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQLEESEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLLGSDGVVHASYDSRQGFNG
TFTVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKAGESIVITCAVFNN
EVVDLQWTYPGQVKGKGITMLEETKVPSIKLVYTLMVPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIKPNFSPLEAVNLHEVKHFVVDVQAYPPPRIAWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFQLLTQVPSSILDL
VDDHHGSNGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEVHPRD
RSMVEGQVTFAKVEETIAVRCLAKNLLGVESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRVLYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccattgggcactcctggtcttaggctgtctcgtcacagggccaagcctt
atcctctgccagctttccttaccctccatcctgcccagtgaaaacgagagggttgtgcag
ctgaattcctccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaatgtggaaatcagagacgaggagaacaacagtggcctt
tttgtgacggtgctggaagtggtcagcgcctcggcggcccacacagggctgtacacttgc
tattacaatcacacgcagttggaagaaagcgagatcgagggcagacgcatttacatctat
gtgccagacccagatgtagccttcgtacctctaggaatgacagattacttggtcatcgtg
gaggacgatgattctgccatcatcccttgtcgaacgactgatcctgagacaccagtgact
ttactcggcagtgacggggtggtgcacgcctcctatgacagcagacaaggcttcaatgga
accttcactgtcggaccctatatctgcgaggccaccgtcagggggaagaagttccagacc
atcccattcaatgtttatgctttaaaagcaacatcagaacttgatctggaaatggaagct
cttaaaactgtctataaggcaggggaatcgattgtgatcacctgcgctgtctttaacaat
gaggttgtggaccttcagtggacttaccctggacaagtgaaaggcaaaggcatcacaatg
ctggaggagaccaaggtcccgtccatcaagctggtgtacactctgatggtccctgaggcc
acggtgaaagatagtggagattacgaatgtgctgcccgccaggccaccaaggaggtcaaa
gaaatgaagaaagtcaccatctctgtgcatgagaaagggtttattgaaatcaaacccaac
ttcagcccgttggaagccgtcaacctgcatgaagtcaaacattttgtggtggacgtgcag
gcctacccccctcccaggatagcctggctcaaggacaacctgactctgattgagaatctc
acggagatcaccactgacatagaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgagctaaggaagaagacagtggccattatactattgtagttcaaaatgaagac
gatgtgaagagctatacttttcaactcttaactcaagttccgtcatccattctggacttg
gtcgacgaccaccatggctctaatgggggccagacagtgagatgcacagctgaaggaacc
cctcttcctgatattgagtggatgatttgcaaggatattaagaaatgtaataacgaaact
tcatggacgattttggccaacaatgtctcaaacatcatcacggaggtccacccccgagac
aggagcatggtggagggccaagtgacattcgccaaagtggaggagaccattgcagtacga
tgcctggctaagaatctcctcggggtggagagccgagagctgaagttggtggctcccact
ctgcgttctgaactcacggtggcggccgcagtcctggtgttgttggtgattgtaatcatc
tcactcattgtcctggttgtcatttggaaacagaaaccaaggtatgaaattcgttggagg
gtcattgaatcaatcagccccgatggacatgaatatatttatgtggacccgatgcaactg
ccttatgactcgagatgggagtttccaagagatggactagtgcttggtcgtatcctgggc
tctggtgcatttgggaaagtggttgaaggaactgcctatggattaagtcggtcccaacct
gtcatgaaagtagcagtgaagatgctaaaacccacagccagatccagtgaaaaacaagcc
ctcatgtccgagctgaagataatgacccacctggggccgcatttaaacattgtgaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcttgagccgccacccagagaag
ccaaagaaagagctggacatttttggattgaaccctgctgacgaaagcacacgaagttac
gttattttatcttttgaaaacaacggtgactacatggacatgaagcaagctgacactaca
cagtatgtccccatgctggaaaggaaagaggtttctaagtactcagacatccagagagtg
ctgtatgatcgcccagcctcatataagaagaaatccatgttagactcagaagtcaaaaac
ctcctttcggatgataactcagaaggccttactttgttggatttgttgagctttacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgggacctggcc
gctcgcaacgtcctcctggcgcaagggaaaatcgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcgaactacgtgtcaaaaggcagcacctttctcccggtgaag
tggatggctcctgagagcatcttcgacaacctctacaccacactgagcgacgtctggtct
tacggcattctgctctgggagatcttttccctcggtggtacaccctaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccac
gccaccagtgaagtctatgagatcatggtgaagtgctggaacagtgagccagagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaagatccacctggacttcctgaagagtgaccatcccgccgtggcacgtatg
cgcgtggactccgacaatgcgtacattggcgtcacctacaaaaacgaggaggacaagctg
aaggactgggagggtggccttgacgagcagaggctgagcgcagacagtggctacatcatc
cctctgcctgacattgaccctgttcctgaagaggaagacctgggcaaaagaaacagacac
agctcgcagacctctgaagagagtgccattgagacaggttccagcagttctaccttcatc
aagagagaggatgagaccatcgaggacatcgacatgatggacgacattggcatagactcc
tcggacctggtggaagacagcttcctgtaa

DBGET integrated database retrieval system