KEGG   Delphinapterus leucas (beluga whale): 111169732
Entry
111169732         CDS       T05885                                 

Gene name
MCL1
Definition
(RefSeq) induced myeloid leukemia cell differentiation protein Mcl-1 isoform X1
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04630  JAK-STAT signaling pathway
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111169732 (MCL1)
   04151 PI3K-Akt signaling pathway
    111169732 (MCL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111169732 (MCL1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111169732 (MCL1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 111169732
NCBI-ProteinID: XP_022419848
UniProt: A0A2Y9MRT2
LinkDB
Position
Unknown
AA seq 351 aa
MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLAAGKEATAGREVGGGEAGEVIGG
SAGPSPPATLAPDARRVARPSPIGAEGPDVTATPARLLFFAPTRRASPPEEMESSVSDAI
MSPEEELDGCEPEPLGKRPSVLPLLELVGEASNSPGKDGSLPSTPPPAEEEEDELYRQSL
EIISRYLREQATGTKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
RTKRDWLVKQRGWDGFVDFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgttcggcctcaagagaaacgcagtgatcggactcaacctctactgtgggggggccgga
ttgggaccggatagcggcagcggcgcctccgctccgggaaggcggcttttggctgcagga
aaggaggccacggccgggcgagaggtagggggaggggaagccggcgaggtgattggcgga
agcgccggcccgagccccccggccactctcgcgcccgacgcccggagggtcgcgcggccc
tcgcccattggcgccgagggccccgacgtcaccgcgacccccgccaggctgctgttcttc
gcgcccacccgccgcgcctcgccgcccgaagagatggaatcctcggtctccgacgccatc
atgtcgcccgaagaggagctggacgggtgcgagccggagcctctagggaagcggccgtcc
gtcctgcctttgctggaattggtcggcgaggccagtaacagcccgggcaaggacggctca
ctcccctcgacgccgcccccagcagaggaggaggaggacgagttgtaccggcagtccctg
gagattatctctcgatacctccgggagcaggcaaccggcaccaaggacgcgaagccactg
ggcgggtctggggccgccagccggaaagcgttagagaccctgcgacgggtcggggacggt
gtgcaacggaaccacgagacggccttccaaggcatgcttcggaaactggacatcaaaaac
gaagacgatgtcaaatctttgtctcgagtgatggtccatgttttcagtgacggagtaaca
aactggggcaggattgtgactctcatttcttttggtgcctttgtggccaaacacttgaag
agtataaaccaagaaagctgcatcgaaccattagcagaaagcatcacagatgttctcgta
aggacaaaacgagactggctagtcaaacaaagaggctgggatgggtttgtggacttcttc
catgtagaggacctagaaggcggcatcagaaatgtgctgctggcttttgcaggtgttgcc
ggagtaggagctggtttggcgtatctaataagatag

DBGET integrated database retrieval system