KEGG   Delphinapterus leucas (beluga whale): 111169858
Entry
111169858         CDS       T05885                                 

Gene name
EIF4E1B
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 1B
  KO
K03259  translation initiation factor 4E
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle03013  RNA transport
dle04066  HIF-1 signaling pathway
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04211  Longevity regulating pathway
dle04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    111169858 (EIF4E1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    111169858 (EIF4E1B)
   04151 PI3K-Akt signaling pathway
    111169858 (EIF4E1B)
   04150 mTOR signaling pathway
    111169858 (EIF4E1B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111169858 (EIF4E1B)
  09149 Aging
   04211 Longevity regulating pathway
    111169858 (EIF4E1B)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111169858 (EIF4E1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dle03019]
    111169858 (EIF4E1B)
   03012 Translation factors [BR:dle03012]
    111169858 (EIF4E1B)
Messenger RNA biogenesis [BR:dle03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     111169858 (EIF4E1B)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     111169858 (EIF4E1B)
Translation factors [BR:dle03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    111169858 (EIF4E1B)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 111169858
NCBI-ProteinID: XP_030616502
LinkDB
Position
Unknown
AA seq 238 aa
MAMFAEAKEAEGGIQKWKKEKEEKEKEEEEAAAGVWVGEEALRKARAEGPVESKLELHPL
LNRWALWFFKNDRSRAWQDNLHLVIKFDTVEDFWAMYNNIQLASKLSSGCDYALFKDGIE
PMWEDSRNRRGGRWLVSLAKQQRHSELDHLWLETLLCLIGESFEEHSREVCGAVINIRTK
GDKIAVWTRETENQEGVLRIGRVYKERLGLSTKTIIGYQAHADTAAKSNSLAKNKFVV
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcgatgtttgctgaggccaaagaggctgagggtggaatccaaaagtggaagaaagag
aaggaggagaaagagaaagaggaagaggaggcagcagcgggggtgtgggtgggtgaggag
gctctgaggaaggcccgggccgagggccccgtggagagcaagctggagttgcacccactg
ctgaacaggtgggctctgtggttcttcaagaatgaccgcagcagggcctggcaggacaac
ctgcatctggtcatcaagtttgacaccgtggaggacttctgggcgatgtacaataacatc
cagctggccagtaagctctcttccggctgtgactacgccctgttcaaggatggcattgag
cccatgtgggaagacagcaggaataggcggggtggccgctggctggtcagcctcgccaag
cagcagcgccacagtgagctggaccacctatggctggagacgctgctgtgtctgatcggg
gagagctttgaggagcacagccgggaggtgtgtggggccgtcatcaacatccgaaccaag
ggggacaagattgccgtatggacgagggagacagagaaccaggagggcgtgctgcgcatt
gggcgtgtctacaaagagcgcctgggactctccacaaagaccatcattgggtaccaggcc
cacgcagacacggctgccaagagcaactccctagccaagaacaaatttgtggtgtga

KEGG   Delphinapterus leucas (beluga whale): 111171941
Entry
111171941         CDS       T05885                                 

Gene name
EIF4E2
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 2 isoform X1
  KO
K03259  translation initiation factor 4E
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle03013  RNA transport
dle04066  HIF-1 signaling pathway
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04211  Longevity regulating pathway
dle04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    111171941 (EIF4E2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    111171941 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    111171941 (EIF4E2)
   04150 mTOR signaling pathway
    111171941 (EIF4E2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111171941 (EIF4E2)
  09149 Aging
   04211 Longevity regulating pathway
    111171941 (EIF4E2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111171941 (EIF4E2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dle03019]
    111171941 (EIF4E2)
   03012 Translation factors [BR:dle03012]
    111171941 (EIF4E2)
Messenger RNA biogenesis [BR:dle03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     111171941 (EIF4E2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     111171941 (EIF4E2)
Translation factors [BR:dle03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    111171941 (EIF4E2)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 111171941
NCBI-ProteinID: XP_022423678
UniProt: A0A2Y9N335
LinkDB
Position
Unknown
AA seq 282 aa
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKMERDRSQSSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKKAGPEPPAATRLLQPVIV
RSLLPTLIALCFSLYQTLWKNSAGFSWLCYSVPPHFHFTNKP
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaacaacaagttcgacgcattgaaagatgacgacagtggggaccacgatcagaatgaa
gaaaacagcacacagaaagatggtgagaaggaaaaaatggaacgagacaggagtcagagc
agcagcaagaggaaggctgttgtccctgggccagcagagcaccccctgcagtataactac
actttctggtactccaggagaacccctggccgtcccaccagctcacagagctacgaacag
aatatcaaacagattggcacctttgcctctgtggagcagttctggaggttttacagccac
atggtacgtcccggggacctgacaggccacagtgacttccatctcttcaaagaaggaatt
aaacccatgtgggaggatgatgcaaataaaaatggtggcaagtggattattcggctgcgg
aagggcttggcatcccgttgctgggagaatctcatcctggccatgttgggggaacagttc
atggttggggaggagatctgtggggctgtggtctctgtccggtttcaggaggacattatt
tcaatatggaataagactgccagcgaccaagccaccacagcccgcatccgggatacgctt
cggcgagtgcttaacctacctcccaacaccattatggagtacaaaacccacaccgacagc
atcaaaaaggctggacctgagccgccagctgccacccgcctgcttcagcctgtcattgtc
aggagcctgttgcccaccctcattgctctttgtttttctttatatcagactctttggaaa
aactcagctggattctcctggctctgttactctgtccctccccatttccattttacaaat
aaaccttag

KEGG   Delphinapterus leucas (beluga whale): 111179092
Entry
111179092         CDS       T05885                                 

Gene name
EIF4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E isoform X2
  KO
K03259  translation initiation factor 4E
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle03013  RNA transport
dle04066  HIF-1 signaling pathway
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04211  Longevity regulating pathway
dle04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    111179092 (EIF4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    111179092 (EIF4E)
   04151 PI3K-Akt signaling pathway
    111179092 (EIF4E)
   04150 mTOR signaling pathway
    111179092 (EIF4E)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111179092 (EIF4E)
  09149 Aging
   04211 Longevity regulating pathway
    111179092 (EIF4E)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111179092 (EIF4E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dle03019]
    111179092 (EIF4E)
   03012 Translation factors [BR:dle03012]
    111179092 (EIF4E)
Messenger RNA biogenesis [BR:dle03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     111179092 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     111179092 (EIF4E)
Translation factors [BR:dle03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    111179092 (EIF4E)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 111179092
NCBI-ProteinID: XP_022438110
UniProt: A0A2Y9NVQ2
LinkDB
Position
Unknown
AA seq 217 aa
MATVEPETTPTPNPPPTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcgactgtggaaccggaaaccacccctactcctaatcccccacctacagaagaagag
aaaacagaatctaatcaggaggttgctaacccagagcactatattaaacatcctttacag
aacagatgggcactctggttttttaaaaatgataaaagcaaaacttggcaagcaaacctt
cggctgatctctaagtttgatactgttgaagacttttgggctctgtacaaccatatccag
ttgtctagtaatttaatgcctggctgtgactactcactttttaaggatggtattgagcct
atgtgggaagatgagaaaaacaaacgaggaggacgatggctcattacattgaacaaacag
cagagacgaagtgacctcgatcgcttttggctagagacactgctgtgccttattggagag
tcttttgatgactacagtgatgatgtatgtggagctgtggttaatgttagagctaaaggt
gataaaatagcaatatggactactgaatgtgaaaacagagaagcagttacacatataggg
agggtatacaaggaaaggttaggacttcctccaaagatagtgattggttatcagtcccat
gcagacacagctactaagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system