KEGG   Delphinapterus leucas (beluga whale): 111170142
Entry
111170142         CDS       T05885                                 

Gene name
MMP9
Definition
(RefSeq) matrix metalloproteinase-9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04657  IL-17 signaling pathway
dle04668  TNF signaling pathway
dle04670  Leukocyte transendothelial migration
dle04915  Estrogen signaling pathway
dle04926  Relaxin signaling pathway
dle05161  Hepatitis B
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05215  Prostate cancer
dle05219  Bladder cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111170142 (MMP9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    111170142 (MMP9)
   04670 Leukocyte transendothelial migration
    111170142 (MMP9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    111170142 (MMP9)
   04926 Relaxin signaling pathway
    111170142 (MMP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111170142 (MMP9)
   05202 Transcriptional misregulation in cancer
    111170142 (MMP9)
   05206 MicroRNAs in cancer
    111170142 (MMP9)
   05205 Proteoglycans in cancer
    111170142 (MMP9)
  09162 Cancer: specific types
   05219 Bladder cancer
    111170142 (MMP9)
   05215 Prostate cancer
    111170142 (MMP9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111170142 (MMP9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111170142 (MMP9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111170142 (MMP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dle01002]
    111170142 (MMP9)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     111170142 (MMP9)
Peptidases and inhibitors [BR:dle01002]
 Metallo peptidases
  Family M10
   111170142 (MMP9)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 DUF4953 Reprolysin_4 Reprolysin_3 Peptidase_M66 PT
Other DBs
NCBI-GeneID: 111170142
NCBI-ProteinID: XP_022420682
UniProt: A0A2Y9MNP1
LinkDB
Position
Unknown
AA seq 709 aa
MNPWQPLVLALLVLGCCSAAPRPHQPTFVVFPGEPRSSLTDRQLAEEYLYRYGYTHVAEI
SKDDQSLRRPLQRLQRRLALPETGELDSTTLNAMRAPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRDVIDDAFARAFALWSAVTPLTFTRVYGREADIVIQFGVREHGDGYP
FDGKNGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNAKGATCHFPFTFEGRS
YSACTTDGRSDDMLWCSTTADYDTDRQFGFCPSERLYTQDGNADGKPCAFPFTFEGRFYS
ACTTDGRSDGYRWCATTASYDQDKLYGFCPTRADATVTEGNSAGELCVFPFIFLGKEYSA
CTREGRRDGQLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYSFTEKHPLHKDDVQGIQHLYGPRPEPEPRPPTTATAEPQPTAPPTVCATGPPTAPHS
ERPTAGSTGPPSAGPTGPPTAGPSAIPTRSLDPADDVCNVNIFDAIAEIGNRLHLFKDGR
YWRLSESGGRPLQGPFFIKNTWPALPRKLDSAFEDPLTKKIFFFSGRQVWVYTGSSVLGP
RRLDKLGLGPEVAQVTGALPRAGGKVLLFSRQSFWRFDVKTQKVDPRSATPVDQMFPGVP
MNTHDIFQYQEKAYFCQDRFYWRVSSQNEVNQVDNVGYVTFDLLQCPED
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgaacccctggcagcccttggtcctggcgctcctggtgctgggctgctgctctgctgcc
cccagaccacaccagcccacctttgtggtcttcccgggagaaccacgaagcagtctcacc
gacaggcagctggcagaggaatatctgtaccgctatggctacactcatgtggcagagata
agcaaggatgatcagtccctgcgtcggcctctgcagcgtctccagcggcgcctggccctg
ccggagacgggcgagctggacagcaccaccctgaatgccatgcgtgccccacgctgcggc
gtcccagacctgggcagattccagacctttgagggcgacctcaagtggcaccatcacaac
atcacctactggatccaaaactactcggaagacttgccgcgcgacgtgatcgacgacgcc
tttgcccgcgccttcgcgctctggagcgcggtgacgccgctcaccttcactcgcgtgtac
ggccgtgaagccgacatagtcatccagtttggtgttagggagcacggagatgggtatccc
ttcgatggaaagaacgggctcctggcacacgcctttcctcctggcccaggcattcaggga
gacgcccacttcgacgatgaagagttgtggtctctgggcaaaggcgtcgtggttccgacc
tacttcggaaacgcaaagggcgccacctgccacttccccttcaccttcgagggccgctcg
tactctgcctgcaccacggacggccgctccgacgacatgctgtggtgcagcaccacggcc
gactacgacaccgaccgccagttcgggttctgccccagcgagagactctacacccaggac
ggcaatgcggacggcaagccctgcgctttccctttcaccttcgagggccgcttctactcc
gcctgtaccaccgacggtcgctcggacggctatcgctggtgcgccaccaccgccagctat
gaccaggacaagctctatggcttctgcccgacccgagctgacgcgacggtgaccgagggc
aactcggcgggggagctgtgcgtcttccccttcatcttcctgggcaaggagtactcggcc
tgcaccagagagggccgccgtgatgggcagctctggtgcgccaccacctccaacttcgac
agagacaagaagtggggcttctgcccggatcaaggatacagcctgttccttgtggcggcg
cacgagtttggccacgcgctgggcttagatcactcgtccgtgccagaggcgctcatgtac
cccatgtacagcttcactgagaagcaccccctgcataaggacgatgtgcagggcatccag
catctgtatggtcctcgccccgaacctgaaccacggcctccaaccactgccacagctgaa
ccgcagcccaccgcccctcccacggtctgcgccacggggcctcccactgccccccactca
gaacgccccactgctggctccacgggccccccttcagctggccccacgggtcctcccact
gctggcccttctgcgatccctacaaggtccctggatccagcagacgatgtctgcaacgtg
aacatcttcgacgccatcgcggagatcgggaatcgcctgcatctcttcaaggatgggagg
tactggcgactctctgagagcgggggacgcccgttgcagggtcccttttttatcaagaac
acgtggcctgcgctgcctcgcaagctggactccgcttttgaggatccgctcacgaagaag
attttcttcttctctgggcgccaagtgtgggtgtacacaggctcgtcggtgctaggccca
aggcgtctggacaagctgggcctgggcccggaagtggcccaagtcaccggggccctcccg
cgcgccgggggtaaggtgctgctgttcagccggcagagcttctggaggttcgacgtgaag
acacagaaggtggatccccggagcgccacaccagtggaccagatgttccccggggtgccc
atgaatacgcacgacatctttcagtaccaagagaaagcatacttctgccaggatcgcttc
tactggcgcgtgagttcccagaatgaggtgaatcaggtggacaatgtgggctacgtgaca
tttgacctcctgcagtgccccgaggactag

DBGET integrated database retrieval system