KEGG   Delphinapterus leucas (beluga whale): 111170218
Entry
111170218         CDS       T05885                                 

Gene name
FZD2
Definition
(RefSeq) frizzled-2
  KO
K02235  frizzled 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111170218 (FZD2)
   04390 Hippo signaling pathway
    111170218 (FZD2)
   04150 mTOR signaling pathway
    111170218 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111170218 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111170218 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111170218 (FZD2)
   05205 Proteoglycans in cancer
    111170218 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111170218 (FZD2)
   05226 Gastric cancer
    111170218 (FZD2)
   05217 Basal cell carcinoma
    111170218 (FZD2)
   05224 Breast cancer
    111170218 (FZD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111170218 (FZD2)
   05022 Pathways of neurodegeneration - multiple diseases
    111170218 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111170218 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111170218 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dle04030]
    111170218 (FZD2)
G protein-coupled receptors [BR:dle04030]
 Frizzled / Smoothened family
  111170218 (FZD2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 111170218
NCBI-ProteinID: XP_022420877
UniProt: A0A2Y9MP97
LinkDB
Position
Unknown
AA seq 565 aa
MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNL
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQG
CEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTP
GGPGGGGSPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEE
TRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL
QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKW
GHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACY
FYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIW
SGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgcggccccgcagcgccctgccccgcctgctgcttccgctgctgctgctgcccgctgcg
gggccagcccagttccacggggagaagggcatctccatcccggaccacggcttctgccag
cccatctccatcccgttgtgcacggacatcgcctacaaccagaccatcatgcccaacctt
ctgggccatacgaaccaggaggacgcaggactggaggtgcaccagttctacccattggtg
aaggtgcagtgctcgcccgaactgcgcttcttcctgtgctccatgtatgcacccgtgtgc
actgtgctggagcaggccatcccgccgtgccgctcgatctgcgagcgcgcgcgccagggc
tgcgaggcgctcatgaacaagttcggcttccagtggccggagcgccttcgctgcgagcac
ttcccccgccacggcgcggagcagatctgcgtgggccagaaccactcggaggacggcgcg
cccgcgttgctcaccaccgcgccgccgccgggcctgcagccgggtgcggggggcaccccg
ggcggcccgggtggcggcggctcgcccccgcgctatgccacgctggagcacccgttccac
tgtccgcgcgtcctcaaggtgccgtcctatctcagctacaagtttctgggcgaacgcgac
tgcgcggctccgtgcgagccggcgcggcccgacggctccatgttcttctcccaggaagag
acgcgctttgcgcgactctggatcctcacctggtccgtgttgtgctgcgcctccaccttt
ttcaccgtcaccacgtacctggtggacatgcagcgcttccgctacccggagcggcccatc
atctttctgtcaggctgctacactatggtgtcggtggcctacatcgcgggcttcgtgctc
caggagcgcgtggtgtgtaacgagcgcttctccgaggacggctaccgtacggtggtgcag
ggcacaaagaaggagggctgcaccatcctcttcatgatgctctacttcttcagcatggcc
agttccatctggtgggtcatcctgtcgctcacctggttcctggcggcgggcatgaagtgg
ggccacgaggccatcgaggccaactcgcagtacttccacctggccgcgtgggccgtgccc
gccgtcaagaccatcacaatcctggccatgggccagattgacggcgacctgctgagcggc
gtgtgcttcgtgggcctcaacagcctggacccgttgcggggcttcgtgctggcgccgctc
ttcgtgtacctgttcataggcacgtccttcctcctggccggtttcgtgtcactcttccgc
atccgtaccatcatgaagcatgacggcaccaagacggagaagctggagcggctcatggtg
cgcatcggcgtgttctcggtgctgtacacggtgcccgccaccatcgtcatcgcctgctat
ttctacgagcaggccttccgagagcactgggagcgctcgtgggtgagccagcactgcaag
agcctggccatcccgtgcccggcgcactacacgccgcgcatgtcacccgacttcaccgtc
tacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcgggattctggatctgg
tccggcaagacgctgcactcgtggaggaagttctacacgcgtctcaccaacagccggcac
ggcgagaccaccgtgtga

KEGG   Delphinapterus leucas (beluga whale): 111171737
Entry
111171737         CDS       T05885                                 

Gene name
FZD7
Definition
(RefSeq) frizzled-7
  KO
K02432  frizzled 1/7
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111171737 (FZD7)
   04390 Hippo signaling pathway
    111171737 (FZD7)
   04150 mTOR signaling pathway
    111171737 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111171737 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111171737 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111171737 (FZD7)
   05205 Proteoglycans in cancer
    111171737 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111171737 (FZD7)
   05226 Gastric cancer
    111171737 (FZD7)
   05217 Basal cell carcinoma
    111171737 (FZD7)
   05224 Breast cancer
    111171737 (FZD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111171737 (FZD7)
   05022 Pathways of neurodegeneration - multiple diseases
    111171737 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111171737 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111171737 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dle04030]
    111171737 (FZD7)
G protein-coupled receptors [BR:dle04030]
 Frizzled / Smoothened family
  111171737 (FZD7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 111171737
NCBI-ProteinID: XP_022423138
UniProt: A0A2Y9N1H2
LinkDB
Position
Unknown
AA seq 574 aa
MLGPRAAPSRSPLGLCTLVIALLGALPAGAGAQQYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDKAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGSAGGGPTAYP
TAPYMPDLPFTALPPGAADGRGRSAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgctgggcccccgcgcggcaccgtcgcgctcgcctctgggcctgtgtactctggtgatt
gcgctgctgggcgcactgcccgcgggcgccggggcgcagcagtatcacggcgagaagggc
atctcagtgccggatcacggcttctgccagcccatctccatcccgctgtgcacggacatc
gcctacaaccagaccatcctgcccaacctgctgggtcacacgaaccaagaggatgcgggc
ctcgaggtgcaccagttctacccgctggtgaaggtgcagtgttctcccgagctgcgcttc
ttcctgtgctccatgtacgcacccgtgtgtaccgtgctcgataaggccatcccgccgtgc
cgctctctgtgcgagcgtgcccgccagggctgtgaggcgctcatgaacaagtttggcttc
caatggcctgagcggctgcgttgcgagaacttccccgtgcacggcgccggagagatctgc
gtgggccagaacacttcggacggctccggcagcgcgggaggcggccccaccgcctatccc
accgcgccctacatgcccgacctgcccttcaccgcgctgcctccgggggccgctgacggc
aggggccgctcagccttccccttctcgtgcccacgccagctcaaggtacccccctacctc
ggctaccgtttcctgggcgagcgcgactgcggcgccccttgcgagccgggccgcgccaac
ggcctcatgtactttaaggaggaggagaggcgcttcgcccgcctctgggtgggcgtgtgg
tcagtgctgtgctgcgcctcgacgctcttcaccgtgcttacctacctagtggacatgcgg
cgcttcagctacccagagcggcctatcatcttcctatcgggctgctatttcatggtggcc
gtggcgcacgtggccggcttcctgttggaggaccgcgcggtgtgcgtggagcgcttctca
gacgacggctaccgcacggtggcgcagggcaccaagaaggaaggttgcaccatcctcttc
atggtgctctacttcttcggcatggccagttccatctggtgggtcatcctgtcgctcacc
tggttcctggcggccggcatgaagtggggccacgaggccatcgaggccaactcgcagtac
ttccacctggccgcgtgggcggtgcccgctgtcaagactatcaccatcctggccatgggc
caggtggacggggacctgctcagcggggtgtgctacgtgggcctgtccagcgtggacgcg
ctgcggggcttcgtgctggcgcccctgttcgtctacctcttcatcggcacgtccttcctg
ctggccggcttcgtgtcgctgttccgcatccgcaccatcatgaagcacgacggcaccaag
accgagaagctggagaagctcatggtgcgcatcggcgtcttcagcgtgctctacaccgtg
ccggccaccatcgttctggcctgctacttctacgagcaggcctttcgcgaacactgggag
cgcacctggctcctgcagacgtgcaagagctacgcggtgccctgcccgcccggccacttc
ccgcccatgagccccgacttcaccgtcttcatgatcaagtacctgatgaccatgatcgta
ggcatcaccactggcttctggatctggtccggcaagacgctgcagtcgtggcgccgcttc
taccacagactcagccacagcagcaagggggagactgcggtatga

KEGG   Delphinapterus leucas (beluga whale): 111171775
Entry
111171775         CDS       T05885                                 

Gene name
FZD5
Definition
(RefSeq) frizzled-5
  KO
K02375  frizzled 5/8
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111171775 (FZD5)
   04390 Hippo signaling pathway
    111171775 (FZD5)
   04150 mTOR signaling pathway
    111171775 (FZD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111171775 (FZD5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111171775 (FZD5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111171775 (FZD5)
   05205 Proteoglycans in cancer
    111171775 (FZD5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111171775 (FZD5)
   05226 Gastric cancer
    111171775 (FZD5)
   05217 Basal cell carcinoma
    111171775 (FZD5)
   05224 Breast cancer
    111171775 (FZD5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111171775 (FZD5)
   05022 Pathways of neurodegeneration - multiple diseases
    111171775 (FZD5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111171775 (FZD5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111171775 (FZD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dle04030]
    111171775 (FZD5)
G protein-coupled receptors [BR:dle04030]
 Frizzled / Smoothened family
  111171775 (FZD5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 111171775
NCBI-ProteinID: XP_022423235
UniProt: A0A2Y9MML7
LinkDB
Position
Unknown
AA seq 588 aa
MARPDPSAPPSLLLLLLAQLAGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTHSGLPGSPASGN
DCAAGGPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDSGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
PRRGHKSGGATAAGDYAEASAALTGRTAPPGPAAAAAAYHKQVSLSHV
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggctcggccagacccgtccgcgccgccttcgctgctgctgctgctcctagcgcagctg
gcgggccgggcggcggccgcctccaaggccccagtgtgccaggaaatcacagtgcctatg
tgccgcggcatcggctacaacctgacgcacatgcccaaccagttcaaccacgacacgcag
gacgaggcgggtctggaggtgcaccagttctggccgctggtggaaatccactgctcgccg
gacctgcgtttcttcctgtgctccatgtacacgcccatctgcctgcccgactaccacaag
ccgctgccgccctgccgctcggtgtgcgagcgcgccaaggccggctgctcgccgctcatg
cgccagtatggctttgcctggccggaacgcatgagctgcgaccgcctcccggtgctgggc
cgcgacgccgaggtcctgtgcatggattacaaccgcagcgaggccaccacggcgcccccc
aggcccttcccggccaagcccacccactcaggcctgccggggtcgccggcctcggggaac
gactgcgccgccgggggcccgtcggtgtgcaagtgccgcgagcccttcgtgcccattctc
aaggagtcgcacccgctttacaacaaggtgaggacgggccaggtacccaactgcgcggtg
ccctgctaccagccgtccttcagccccgacgagcgcacgttcgccaccttctggatcggc
ctgtggtctgtactgtgcttcatctccacctccaccacggtggccaccttcttaatagac
atggaacgcttccgctaccctgagcgccccatcatcttcctgtcagcctgctacctgtgc
gtgtctctgggcttcctggtgcgtctggtcgtgggccatgccagcgtcgcctgcagccgc
gagcacagccacatccactacgagacaacgggccctgcgctgtgcactgtcgtcttcctg
ctggtctacttctttggcatggccagttccatctggtgggtcatcctgtcgctcacctgg
ttcttggcggctggcatgaagtggggcaacgaggccattgcgggctatgcgcagtacttc
cacctggccgcgtggctcatccccagtgtcaagtccatcactgcgctggcactgagctcc
gtggacggggacccggtggccggcatctgctacgtggggaaccagaacctgaactcgctg
cgcggcttcgtgctgggcccgctggtgctctacctgctggtgggcacgctcttcctcctg
gcgggcttcgtgtcgctcttccgcatccgcagcgtcatcaagcagggcggcaccaagacg
gacaagctggagaagctcatgatccgcatcggcatcttcacgctgctctacactgtgcca
gccagcatcgtggtcgcatgctacctgtacgaacagcactatcgcgagagctgggaggct
gcgctcacctgcgcgtgccccggcccggactctggccagccgcgcgccaagcccgagtac
tgggtgctcatgctcaagtacttcatgtgccttgtggtgggcatcacgtcgggcgtttgg
atttggtccggcaagactgtggagtcgtggcggcgcttcaccagtcgctgctgctgccgc
ccgcggcggggccacaagagcggcggcgccacggccgccggggactacgccgaggcgagc
gcagcgctcacgggcaggaccgcgccgccgggccccgccgccgccgccgccgcctatcac
aagcaggtgtccctgtcgcacgtgtag

KEGG   Delphinapterus leucas (beluga whale): 111177938
Entry
111177938         CDS       T05885                                 

Gene name
FZD8
Definition
(RefSeq) frizzled-8
  KO
K02375  frizzled 5/8
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111177938 (FZD8)
   04390 Hippo signaling pathway
    111177938 (FZD8)
   04150 mTOR signaling pathway
    111177938 (FZD8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111177938 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111177938 (FZD8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111177938 (FZD8)
   05205 Proteoglycans in cancer
    111177938 (FZD8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111177938 (FZD8)
   05226 Gastric cancer
    111177938 (FZD8)
   05217 Basal cell carcinoma
    111177938 (FZD8)
   05224 Breast cancer
    111177938 (FZD8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111177938 (FZD8)
   05022 Pathways of neurodegeneration - multiple diseases
    111177938 (FZD8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111177938 (FZD8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111177938 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dle04030]
    111177938 (FZD8)
G protein-coupled receptors [BR:dle04030]
 Frizzled / Smoothened family
  111177938 (FZD8)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR PhaG_MnhG_YufB
Other DBs
NCBI-GeneID: 111177938
NCBI-ProteinID: XP_022435910
UniProt: A0A2Y9NPK6
LinkDB
Position
Unknown
AA seq 531 aa
MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRPPPPPPPPPGEQPP
SGSGHGRPPGARPPGAGGAGAGAGAAGAGAGGPGGRGEYEELGAVEQHVRYETTGPALCT
VVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVL
ALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQ
GGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQ
ARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRALCTRCCWASKGAGAAGAGAAGG
GPGGGGPGAGGGVGPGGGAGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtgacctcgttgctggcagccctggcgctactgcag
cgctccagcggcgctgcggccgcctcggccaaggagctggcgtgccaggagatcaccgtg
ccgctatgcaagggcatcggctacaactacacctatatgcccaaccagttcaaccacgac
acgcaggacgaggcgggcctggaggtgcaccaattttggccgctggtggagatccagtgc
tcgcccgacctcaagttcttcctgtgcagcatgtacacgcccatctgcctggaggactac
aagaagcccctgcctccctgccgctcggtatgcgagcgcgccaaggccggctgcgcgccc
ctcatgcgccagtacggcttcgcctggcccgaccgcatgcgctgcgacaggctgcccgag
cagggcaaccctgacacgctgtgcatggactacaaccgcaccgacctcaccacggccgcg
cccagtccaccgcggcgcccgccgccgccgccgccgccgccgcccggcgagcagccgccc
tccggcagcggccacggccgcccgcccggagcccggcccccgggcgccgggggcgcgggg
gcgggcgcgggggcggcgggcgcgggcgcgggcggcccgggcgggcgcggcgagtacgag
gagctgggtgccgtagagcagcacgtgcgctacgagaccacgggcccggcgctttgcacc
gtagtcttcctgctcgtctacttcttcggcatggccagctccatctggtgggtgatcctg
tcgctcacgtggttcctggcggcgggcatgaaatggggcaatgaggccatcgccgggtac
tcgcagtacttccacctggccgcgtggctcgtgcccagcgtcaagtctatcgccgtgctg
gcgctcagctcggtggacggcgacccggtggcgggcatctgctacgtgggcaaccagagc
ctggacaacctgcgcggcttcgtgctggcgccgctggtcatctacctcttcatcggcacc
atgttcctgctggccggcttcgtgtcgctcttccgcatccgctcggtcatcaagcagcag
ggcggccccaccaagacacataagctggagaagctcatgatccgcctgggcctcttcacc
gtgctctacaccgtgcccgccgccgtcgtggtcgcctgccttttctacgagcagcacaac
cgcccgcgctgggaggccacgcacaactgcccgtgcctgcgggacctgcagccggaccag
gcgcgccggcccgattacgccgtcttcatgctcaagtacttcatgtgcctggtggtgggc
atcacgtcgggcgtgtgggtctggtctggcaagacgctcgagtcgtggcgcgcgctgtgc
acccgctgctgctgggccagcaaaggcgcgggcgcggccggcgcgggcgcggcggggggc
ggccccgggggcgggggcccgggggccggcgggggcgtggggccgggcggtggggcgggc
tccctgtacagcgacgtcagcaccggcctgacgtggcggtctggcacggccagctccgtg
tcttatccaaagcagatgccattgtcccaggtctga

KEGG   Delphinapterus leucas (beluga whale): 111180361
Entry
111180361         CDS       T05885                                 

Gene name
FZD6
Definition
(RefSeq) frizzled-6
  KO
K02376  frizzled 6
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111180361 (FZD6)
   04390 Hippo signaling pathway
    111180361 (FZD6)
   04150 mTOR signaling pathway
    111180361 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111180361 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111180361 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111180361 (FZD6)
   05205 Proteoglycans in cancer
    111180361 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111180361 (FZD6)
   05226 Gastric cancer
    111180361 (FZD6)
   05217 Basal cell carcinoma
    111180361 (FZD6)
   05224 Breast cancer
    111180361 (FZD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111180361 (FZD6)
   05022 Pathways of neurodegeneration - multiple diseases
    111180361 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111180361 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111180361 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dle04030]
    111180361 (FZD6)
G protein-coupled receptors [BR:dle04030]
 Frizzled / Smoothened family
  111180361 (FZD6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec Integrin_alpha RseC_MucC
Other DBs
NCBI-GeneID: 111180361
NCBI-ProteinID: XP_022440361
UniProt: A0A2Y9P561
LinkDB
Position
Unknown
AA seq 712 aa
METFTFLWTCIFLPLIRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEL
FLPLANLECSPNVETFLCKAFVPTCTEQIDVVPPCRKFCEKVYSDCKKLMDTFGIRWPEE
LECDRLQYCDESVPVTFDQHTEFLSPHKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQ
CAPPCPNMYFKSDELEFAKSFIGIVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGNSTACNKADEKLELGDTVVLGSQNKACTVLFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGIPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKTETRPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRSRKKDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITNHDYLGQETLTEIQTSPETSVREV
RADGASTSKLREQDCEEPASPAASSSKLCGEQTDGKGRAANVNDKSSVSESARSEGRVTP
KSDVTETGPVQSNSLHVPRSSEPSSLKGSTSLLVHSASGVGKEQGTGGHSDT
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggaaacgtttacatttttgtggacatgtatttttctacccctcatacgagggcacagt
cttttcacctgtgaaccaattactgttcccagatgtatgaaaatggcctacaacatgaca
tttttccctaatctgatgggtcattatgaccagagtattgcggctgtggaaatggagctt
tttcttcctcttgcaaatctggaatgttcaccaaatgttgaaactttcctttgcaaagct
tttgtaccaacctgcacagagcaaattgatgtggttccaccctgtcgtaaattttgtgag
aaagtgtattctgactgcaaaaagttaatggacacttttgggatccgatggcctgaggaa
cttgaatgtgacagattacaatactgtgacgagtctgttcctgtaacttttgatcaacac
acagagtttctcagtcctcacaagaaaacagaacaagtccaaagagacattggattttgg
tgtccaaggcatcttaagacttctgggggacaaggctataagtttctgggaattgaccaa
tgtgcacctccatgccccaacatgtattttaaaagtgatgagctagaatttgcaaaaagt
tttattggaatagtttcaatattttgtctttgtgcaactctgtttacattccttactttt
ttaattgatgttagaaggttcagataccctgagagaccaattatatattactctgtctgt
tacagcattgtatctcttatgtacttcattggattcttgctaggcaatagcacagcctgc
aataaggcagatgagaaactagaacttggtgacacagttgttctaggctctcaaaataag
gcttgcaccgttttgtttatgtttttgtattttttcacaatggctggcactgtgtggtgg
gtgattcttaccattacttggttcttagctgctgggagaaaatggagttgtgaagccatt
gaacagaaagcagtgtggtttcatgctgttgcatggggaataccaggttttctgaccgtt
atgcttcttgctatgaacaaagttgaaggagacaatattagtggagtttgctttgtcgga
ctttatgacctggatgcctctcgctactttgtactcttgccactgtgcctttgtgtgttt
gtcgggctctctcttcttttagctggcattatttccttaaaccatgttcgacaagttata
caacatgatggccggaaccaagagaaactaaagaaatttatgattcgaattggagtcttc
agtggcctgtatcttgtgccattagtgacacttcttggatgttacgtctatgagcaagtg
aacaggataacctgggagataacttgggtctctgaccattgtcgtcagtaccacatccca
tgtccttaccaggccaaaacagaaactcgaccagagttggctttatttatgataaaatat
ctgatgacattaattgttggcatctctgctgtcttctgggttggaagcaaaaagacatgc
acagaatgggctgggttttttaaacgaagtcgcaagaaagatccaatcagtgaaagtcga
agagtactacaggagtcgtgtgagtttttcttaaagcacaattctaaagttaaacacaaa
aagaagcactacaaaccaagttcacataagctgaaggtcatttccaaatccatgggaacc
agcacaggagctacagcaaatcatggcacttctgcagtagcaatcactaaccatgattac
ttaggacaagaaactttgacagaaatacaaacctcaccagaaacatcagtgagagaggtg
agagcagatggagcgagcacctccaaattacgagaacaggactgtgaggaacctgcctcc
ccagcagcatccagctccaaactctgcggggaacagactgacgggaaaggccgggcagcc
aatgtgaatgataagagcagtgtgtctgaaagtgcacggagtgaaggaagggtgactcca
aagagtgatgtcactgaaactggcccagtgcagagcaacagcttgcatgttcccaggtct
tcagagccaagcagcctcaaaggctccacgtcactgcttgttcactcagcgtcaggagtt
ggaaaagagcagggcactggtggtcactcagatacttga

KEGG   Delphinapterus leucas (beluga whale): 111180740
Entry
111180740         CDS       T05885                                 

Gene name
FZD1
Definition
(RefSeq) frizzled-1
  KO
K02432  frizzled 1/7
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111180740 (FZD1)
   04390 Hippo signaling pathway
    111180740 (FZD1)
   04150 mTOR signaling pathway
    111180740 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111180740 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111180740 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111180740 (FZD1)
   05205 Proteoglycans in cancer
    111180740 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111180740 (FZD1)
   05226 Gastric cancer
    111180740 (FZD1)
   05217 Basal cell carcinoma
    111180740 (FZD1)
   05224 Breast cancer
    111180740 (FZD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111180740 (FZD1)
   05022 Pathways of neurodegeneration - multiple diseases
    111180740 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111180740 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111180740 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dle04030]
    111180740 (FZD1)
G protein-coupled receptors [BR:dle04030]
 Frizzled / Smoothened family
  111180740 (FZD1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 111180740
NCBI-ProteinID: XP_022441075
UniProt: A0A2Y9P4M0
LinkDB
Position
Unknown
AA seq 644 aa
MAEEEAPKKSRAAAASGASWELCAGTLRTGPVAEGSGDVGSRRRLPRVDSGRLARGVLLL
IWLLEAPLLLGVRAQAAGQGPGPGQQPPPPQQQQSGQQYNGERGISIPDHGYCQPISIPL
CTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQA
LPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLL
PEFWTSNPQHGGGGYRGGGFAGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPCEP
TKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCY
TAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVI
LSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLN
NVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSV
LYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGAPPHPPMSPDFTVF
MIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1935 nt   +upstreamnt  +downstreamnt
atggctgaggaggaggcgcctaagaagtctcgggccgccgccgccagcggcgcaagctgg
gaactttgtgccgggacgctccgcactggaccggtggcggaggggagcggggacgtgggc
agccgccgccgtctcccccgagttgactccgggcgcttggcgcgcggagtgctactactg
atttggctgctggaggctccgctgctgctgggggtccgggcgcaggcggccggccagggg
cccgggccggggcagcagcccccgccgcctcagcagcagcagagcgggcagcagtacaac
ggcgagcggggcatctccataccggaccacggctactgccagcccatctccatcccgctg
tgcacggacatcgcgtacaaccagaccatcatgcccaacctgctgggccacacgaaccag
gaggatgcgggcctcgaggtgcaccagttctacccgctagtgaaggtgcagtgctccgcg
gagctcaagttcttcctgtgctccatgtacgcgcccgtgtgcaccgtgctggagcaggct
ctgccgccttgccgctccttgtgcgagcgcgcgcgccagggctgcgaggcgctcatgaac
aagttcggcttccagtggcctgacacgctcaagtgcgagaagttcccggtgcacggcgct
ggcgagctgtgcgtgggccagaacacgtcggacaagggcaccccgacgccctcgctgctg
cctgagttctggaccagcaacccacagcacggcggcggagggtacagggggggcggcttc
gcggggggcgccggcgcgtcggaacgaggcaagttctcgtgcccgcgcgccctcaaggtg
ccctcctacctcaactaccacttcctgggggagaaggactgcggcgcgccctgcgagccg
accaaggtatacgggcttatgtattttgggccggaggagctgcgcttctcgcgcacctgg
atcggcatctggtcagtgctatgctgcgcctccacgctcttcacggtgctcacgtacctg
gtggacatgcggcgcttcagctacccggagcggcccatcatcttcctgtcgggctgctac
acggcagtggccgtggcctacatcgccggcttcctgctggaggaccgggtggtgtgtaac
gacaaattcgccgaggacggggcgcgcacagtggcgcagggcaccaagaaggagggctgc
accatcctcttcatgatgctctacttcttcagcatggccagctccatctggtgggtgatc
ctttctctcacctggttcctcgcggccggcatgaagtggggccacgaggccatcgaggcc
aactcgcagtattttcacctggccgcctgggccgtgccggccattaagaccatcaccatc
ctggcgctgggccaggtggacggtgatgtgctgagcggggtgtgcttcgtggggctcaac
aacgtggacgcactgcgcggcttcgtgctggcgccactcttcgtgtacctgttcatcggc
acgtccttcctactggccggcttcgtgtccctcttccgcattcgcactatcatgaaacac
gacggcaccaagacagagaagctggagaagctcatggtgcgcatcggcgtcttcagcgtg
ctctacacggtgccagccactatcgtcattgcctgctacttctacgagcaggccttccgg
gaccagtgggagcgcagctgggtggcccagagctgcaagagctatgctatcccctgcccc
cacctccaggcgggcggcgccccgccgcacccgcccatgagccctgacttcacagtcttc
atgatcaagtatcttatgacgctgatcgtgggcatcacgtcaggcttctggatctggtcc
ggcaagaccctcaactcctggaggaagttctacactaggctcaccaatagcaaacagggg
gagaccaccgtctga

KEGG   Delphinapterus leucas (beluga whale): 111182319
Entry
111182319         CDS       T05885                                 

Gene name
FZD9
Definition
(RefSeq) frizzled-9
  KO
K02842  frizzled 9/10
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111182319 (FZD9)
   04390 Hippo signaling pathway
    111182319 (FZD9)
   04150 mTOR signaling pathway
    111182319 (FZD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111182319 (FZD9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111182319 (FZD9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111182319 (FZD9)
   05205 Proteoglycans in cancer
    111182319 (FZD9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111182319 (FZD9)
   05226 Gastric cancer
    111182319 (FZD9)
   05217 Basal cell carcinoma
    111182319 (FZD9)
   05224 Breast cancer
    111182319 (FZD9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111182319 (FZD9)
   05022 Pathways of neurodegeneration - multiple diseases
    111182319 (FZD9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111182319 (FZD9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111182319 (FZD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dle04030]
    111182319 (FZD9)
   04090 CD molecules [BR:dle04090]
    111182319 (FZD9)
G protein-coupled receptors [BR:dle04030]
 Frizzled / Smoothened family
  111182319 (FZD9)
CD molecules [BR:dle04090]
 Proteins
  111182319 (FZD9)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 111182319
NCBI-ProteinID: XP_022444359
UniProt: A0A2Y9PBR4
LinkDB
Position
Unknown
AA seq 590 aa
MAVPPLRRALLLWQLLAAGGAALEIGRFDPERGRGPAPCQAVEIPMCRGIGYNLTRMPNL
LGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARL
RCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPA
GPPGDAILGAAGGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSAL
CFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGAL
YVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMA
AWGLPALKTIVILTLRKVAGDELTGLCYVASMDAGALTGFVLVPLSCYLVLGTSFLLTGF
VALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRAT
EQPCSAATTPGGWRDCSLQGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLC
HRKMAAGRARAKTCRAPGGYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggccgtgccgccgctccgccgggcgctgctgctgtggcagctgctggcggcgggcggc
gcggcgctggagatcggccgcttcgacccggagcgcgggcgcgggccggcgccgtgccag
gcggtggagatccccatgtgccgcggcatcggctacaacctgacccgcatgcccaacctg
ctgggccacacgtcgcagggcgaggcggccgccgagctggccgagttcgcgcctctcgtg
cagtacggctgccacagccacctgcgcttcttcctgtgctcgctctacgcgcccatgtgc
accgaccaggtctcgacgcccatccccgcttgccggcccatgtgcgagcaggcgcgcctg
cggtgcgcgcccatcatggagcagttcaacttcggctggccggactcgctggactgcgcc
cggctgcccacgcgcaacgacccgcacgcgctctgcatggaggcgcccgagaacgccacg
gccggccccgccgagccccacaagggcctaggcatgctgcccgtggcgccgcggcccgcg
gggccccccggcgacgccatcctaggcgccgccggcggcacctgtgagaaccccgagaag
ttccagtacgtggagaagagccgctcgtgcgcgccgcgctgcgggccgggcgtcgaggtg
ttctggtcgcggcgcgacaaggacttcgcgctcgtctggatggccgtgtggtcggcgctg
tgcttcttctccactgccttcaccgtgctcaccttcttgctggaacctcaccgcttccag
tacccggagcgccccatcattttcctttccatgtgctacaacgtctactcgctagccttc
ctcatccgggctgtggctggggcccagagcgtggcttgtgaccaggaggcgggtgcgctc
tacgtgatccaggagggcctggagaacacgggctgcaccctcgtcttcctgctgctctac
tacttcggcatggccagctcgctgtggtgggtggtgctgaccctcacctggttcctggcg
gccggcaagaagtggggccacgaggccattgaggcccacggcagctacttccacatggca
gcctgggggctgccggctctcaagaccatcgttatcctgactctgcgcaaggtggcaggg
gatgagctgaccgggctctgttacgtggccagcatggatgcgggggcactcacgggcttc
gtgctggtacccctctcctgctacctggtgctgggcacgagcttcctcctgaccggcttt
gtggccctcttccacatccgcaagatcatgaagacagggggcaccaacacggagaagctg
gagaagctcatggtcaagattggggtcttctccatcctctacactgtgcccgccacctgc
gtcattgtgtgctacgtctatgaacgcctcaacatggacttctggcgcttgcgggccaca
gagcagccctgctcggcagccaccacgcccggcggctggagggactgctcgctgcaaggg
ggctcagtgcccaccgtggctgtctttatgctgaaaatcttcatgtcgctggtggtgggc
atcaccagcggcgtctgggtatggagctccaagactttccagacctggcagagcctgtgc
caccgcaagatggcagctggccgggcacgggcaaagacctgccgggcccccgggggctat
ggccgtggcacccactgccactataaggcccccaccgtggtcttgcacatgactaagacg
gatccttctctggagaaccccacacacctctag

KEGG   Delphinapterus leucas (beluga whale): 111184951
Entry
111184951         CDS       T05885                                 

Gene name
FZD4
Definition
(RefSeq) frizzled-4
  KO
K02354  frizzled 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111184951 (FZD4)
   04390 Hippo signaling pathway
    111184951 (FZD4)
   04150 mTOR signaling pathway
    111184951 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111184951 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111184951 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111184951 (FZD4)
   05205 Proteoglycans in cancer
    111184951 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111184951 (FZD4)
   05226 Gastric cancer
    111184951 (FZD4)
   05217 Basal cell carcinoma
    111184951 (FZD4)
   05224 Breast cancer
    111184951 (FZD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111184951 (FZD4)
   05022 Pathways of neurodegeneration - multiple diseases
    111184951 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111184951 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111184951 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dle04030]
    111184951 (FZD4)
   04090 CD molecules [BR:dle04090]
    111184951 (FZD4)
G protein-coupled receptors [BR:dle04030]
 Frizzled / Smoothened family
  111184951 (FZD4)
CD molecules [BR:dle04090]
 Proteins
  111184951 (FZD4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 111184951
NCBI-ProteinID: XP_022449766
UniProt: A0A2Y9PX74
LinkDB
Position
Unknown
AA seq 537 aa
MAWRGAGPRVLGAPGGVGLSLRLLLLLLLLMRPARGFGDEEERRCDPIRISMCQNLGYNV
TKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKVNIPIGPCGGM
CLSVKRRCEPVLKEFGFAWPDSLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
CHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLT
FLIDSARFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTI
VILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLK
IFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGRGNETVV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggcctggcggggcgcagggccgcgcgtcctgggggccccagggggcgtcggtctcagc
ctgcggctgctgctactcttgctgctgctcatgaggccggcgcggggcttcggggacgag
gaggagcggcgctgcgaccccatccgcatctctatgtgccagaacctgggctacaacgtg
accaagatgcccaacctggtggggcacgagctgcagacggacgccgagctgcagctgaca
actttcacgccgctcatccagtacggctgctccagccagctgcagttcttcctttgttcc
gtgtatgtgcccatgtgcacagagaaggtcaatatccccatcggcccctgcggcgggatg
tgtctttcggtcaagagacgttgcgagcctgtcctgaaggaatttggatttgcctggcca
gatagcctgaactgcagcaaattcccaccacagaatgaccacaaccacatgtgcatggaa
gggccaggtgatgaggaggtgcccttacctcacaaaacccccatccagcctggggaagag
tgccattccgtgggaaccaactctgatcagtacatctgggtgaagaggagcctgaactgc
gttctcaagtgtggctatgatgctggcttatacagccgctcggccaaggagttcaccgat
atctggatggccgtgtgggccagcctgtgcttcatctctaccgccttcactgtgctgacc
ttcctgatcgattctgccaggttttcctacccggagcgccccatcatatttctcagtatg
tgctataatatttatagcattgcttatattgtcaggctgactgtaggccgggaaaggata
tcctgcgattttgaagaggcagcagaacctgttctcatccaagaaggacttaagaacaca
ggatgtgcaatcattttcttgctgatgtacttttttggaatggccagttccatctggtgg
gttattctgacactcacttggtttttggcagcgggactcaaatggggtcatgaagccatt
gaaatgcacagctcttatttccacattgcagcctgggctatccctgcagtgaaaaccatt
gtcatcttgattatgagactggtggatgcagatgaactgactggcctgtgctacgtgggg
aaccaaaaccttgatgccctcacgggctttgtggtggctcctctcttcacttacttggtg
attggaactttgttcattgctgcaggcttggtggccttgttcaaaattcggtcgaatctt
caaaaggatgggacaaagacagacaagttggaaaggctgatggtcaagattggggtcttc
tcagtcctgtacacggttcctgcaacctgtgtgattgcctgttatttctatgaaatctcc
aactgggcgctgttccggtattccgcagatgactccaatatggcggttgagatgttgaaa
atttttatgtctttgctggtaggcatcacttcaggcatgtggatttggtctgccaaaact
cttcacacgtggcagaagtgttccaacagattggtgaattctgggaaggtaaagagagaa
aaaagagggaatggttgggtgaagcctgggagaggcaatgaaactgtggtataa

KEGG   Delphinapterus leucas (beluga whale): 111185390
Entry
111185390         CDS       T05885                                 

Gene name
FZD3
Definition
(RefSeq) frizzled-3
  KO
K02329  frizzled 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04360  Axon guidance
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111185390 (FZD3)
   04390 Hippo signaling pathway
    111185390 (FZD3)
   04150 mTOR signaling pathway
    111185390 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111185390 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111185390 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    111185390 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111185390 (FZD3)
   05206 MicroRNAs in cancer
    111185390 (FZD3)
   05205 Proteoglycans in cancer
    111185390 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111185390 (FZD3)
   05226 Gastric cancer
    111185390 (FZD3)
   05217 Basal cell carcinoma
    111185390 (FZD3)
   05224 Breast cancer
    111185390 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111185390 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    111185390 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111185390 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111185390 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dle04030]
    111185390 (FZD3)
G protein-coupled receptors [BR:dle04030]
 Frizzled / Smoothened family
  111185390 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 111185390
NCBI-ProteinID: XP_022450670
UniProt: A0A2Y9PYV8
LinkDB
Position
Unknown
AA seq 666 aa
MAMSWIVFILWPLTLFVGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDSLRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLIVF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSTNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctatgagttggatcgtcttcattctgtggcccttgactttgtttgtggggcatata
ggtgggcacagtttgttttcttgtgaacctattaccttgaggatgtgccaagatttgcct
tataatactaccttcatgcctaatcttctgaatcattatgaccaacagacagcagcttta
gcaatggagccattccaccctatggtgaatttggattgttctcgggatttccggccattt
ctttgtgcactctacgctcctatttgtatggaatacggacgtgtcacacttccctgccgt
aggctctgtcagcgggcttacagtgagtgttcgaagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgatgagccgtatcctcgactt
gtggatctgaatttagctggagatcctactgaaggagccccagtggcagtgcagagggac
tatggtttttggtgtccccgagagttgaaaattgatcctgatcttggctattcttttttg
cacgtgcgtgattgttcacctccttgtccaaatatgtactttaggagagaagaactttca
tttgctcgatatttcataggattgatttcaatcatttgcctctctgccacattatttact
tttttaacttttttgattgatgtcacaagattccgttatcctgaaaggcctattatattt
tatgcagtctgctacatgatggtgtcgttaattttctttattgggtttttgcttgaggac
cgagtagcctgcaatgcatctagccctgcacagtataaggcttccacagtgacacaagga
tctcataataaagcctgtaccatgctttttatggtactctatttttttactatggctggc
agcgtttggtgggtaattcttaccatcacgtggttcttggcagctgtgccaaagtggggt
agtgaagctattgagaagaaggcactgctatttcacgccagcgcgtggggcatccctgga
actctaactatcatccttttagcgatgaataaaattgaaggtgacaatatcagtggcgtg
tgttttgttggcctctacgatgtcgattcattgaggtattttgttcttgcacccctctgc
ctgtatgtggtagttggggtttcacttctcttagccggcatcatatccctaaacagagtt
cgaattgagattccattagaaaaggagaaccaagataaactggtgaagtttatgatccgg
attggtgttttcagcattctttatcttgtaccactcttggttgtaattggatgctacttt
tatgagcaagcttaccgtggcatctgggaaacaacatggatacaagaacgctgcagagaa
tatcacattccatgtccatatcaggtcactcaaatgagtcgtccagacctgattgtcttt
ctgatgaaatacctgatggctctcatagttggtattccttccattttttgggttggaagc
aaaaagacatgctttgaatgggccagtttttttcatggtcgtaggaaaaaagagatagtg
aatgagagccgacaggtactccaggaacctgatttcgctcagtccctcctgagggatcca
aatactcctattataagaaaatcaagaggaacttccactcaaggaacatccacacatgct
tcttcaactcagctggccatggtggatgatcagagaagcaaagcagggagtgtccacagc
aaagtgagcagctaccatggcagcctccacagatcccgtgatggcaggtacactccctgc
agttacagaggaatggaggagagactacctcatggcagcatgtcacgactcacggatcac
tccaggcacagtagttctcatcggctcaatgaacagtcacgacatagcagcatcagagat
ctcagtactaatcctatgactcacatcacacatggcaccagcatgaatcgggttattgaa
gaagatggaaccagtgcttaa

KEGG   Delphinapterus leucas (beluga whale): 111186950
Entry
111186950         CDS       T05885                                 

Gene name
FZD10
Definition
(RefSeq) frizzled-10
  KO
K02842  frizzled 9/10
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111186950 (FZD10)
   04390 Hippo signaling pathway
    111186950 (FZD10)
   04150 mTOR signaling pathway
    111186950 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111186950 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111186950 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111186950 (FZD10)
   05205 Proteoglycans in cancer
    111186950 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111186950 (FZD10)
   05226 Gastric cancer
    111186950 (FZD10)
   05217 Basal cell carcinoma
    111186950 (FZD10)
   05224 Breast cancer
    111186950 (FZD10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111186950 (FZD10)
   05022 Pathways of neurodegeneration - multiple diseases
    111186950 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111186950 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111186950 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dle04030]
    111186950 (FZD10)
   04090 CD molecules [BR:dle04090]
    111186950 (FZD10)
G protein-coupled receptors [BR:dle04030]
 Frizzled / Smoothened family
  111186950 (FZD10)
CD molecules [BR:dle04090]
 Proteins
  111186950 (FZD10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 111186950
NCBI-ProteinID: XP_022453760
UniProt: A0A2Y9Q841
LinkDB
Position
Unknown
AA seq 581 aa
MQLPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPARGSGMFPPLFRPQRPHSAQEN
QLKDGGPGRAGCDNPGKFRHVEKSASCAPLCTPGVDVYWSRDDKHFAVVWLAVWSVLCFF
SSAFTVLTFLIDPARFRYPERPVIFLSMCYCVYSVGYIIRLFAGAESVACDRDSGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
IPAVKTILILVMRRVAGDELTGVCYVGSMDGNALTGFVLLPLACYLIIGTSFILSGFVAL
FHIRRVMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNVEYWKILATQHK
CKMNNQTKNLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWVWTSKTLQSWQNVCSRRFK
KKSRRKPASVITSSGIYKKAQHPPKTHLGKYEIPAQPPTCV
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgcagctcccgggcccccgcctgtggctggtccttcaggtgatgggctcgtgcgccgcc
atcagctccatggacatggagcgtccgggcgacggcaagtgccagcccatcgagatcccg
atgtgcaaggacattggctacaacatgacccgcatgcccaacctgatgggccacgagaac
cagcgcgaggccgccatccagctgcacgagttcgcgccgctggtggagtacggctgccac
ggccacctccgcttcttcctgtgctccctgtacgcgcccatgtgcaccgagcaagtctcc
acccccatccccgcctgccgggtcatgtgcgagcaggcccggctcaagtgctccccgatc
atggagcagttcaacttcaagtggcccgactcgctggactgcagcaaactccccaacaag
aacgaccccaattacctgtgcatggaggcgcccaacaacggctcggacgagcccgcgcgg
ggctcgggcatgttcccgccgctcttccggccgcagcggccgcacagcgcgcaggagaac
cagctgaaggacggggggcccgggcgcgccggctgcgacaacccgggcaagttccgccac
gtggagaagagcgcgtcgtgcgcgccgctctgcacgccgggcgtggacgtctactggagc
cgcgacgacaagcacttcgccgtggtctggctggccgtgtggtccgtgctctgcttcttc
tccagcgccttcaccgtgctcaccttcctcatcgacccggcgcgcttcagataccccgag
cgccccgtcatcttcctctccatgtgctactgcgtctactcggtgggctacatcatccgc
ctcttcgcgggcgccgagagcgtcgcctgcgaccgggacagcgggcagctgtacgtcatc
caggaggggcttgagagcacgggctgcaccctggtcttcctggttctctactacttcggc
atggccagctccctgtggtgggtgattctcacgctcacctggtttctggctgcgggcaag
aagtggggccacgaggccatcgaggccaacagcagctacttccacctggccgcctgggcc
atcccggccgtgaagaccatcctaatcctggtgatgcgcagggtcgcgggggacgagctg
accggcgtctgctacgtggggagcatggacggcaacgccctcaccggctttgtcctcctc
ccgctggcctgttacctcatcatcggaacttcctttatcctctcgggcttcgtggccctt
ttccacatccggagggtgatgaaaacgggcggggagaacacggacaaactggaaaagctc
atggtgaggataggggtcttctccgtgctctacacggtgccggccacctgtgtgattgcc
tgttacttttacgaacgcctcaacgtggagtattggaaaatcctggccacgcagcacaag
tgcaaaatgaacaaccagactaaaaacctggactgtctgatggccgcctccatccccgcg
gtggagatcttcatggtgaagattttcatgctgttggtggtgggcatcaccagtggcatg
tgggtctggacatccaagactctgcagtcctggcagaacgtttgcagccgcaggttcaag
aaaaagagccgaagaaaaccggccagcgtgatcaccagcagtggaatttacaaaaaagcc
cagcatcccccaaaaacccatctcgggaaatatgaaatccctgcccagcctcccacctgc
gtgtga

DBGET integrated database retrieval system