KEGG   Delphinapterus leucas (beluga whale): 111170230
Entry
111170230         CDS       T05885                                 

Gene name
GFAP
Definition
(RefSeq) glial fibrillary acidic protein isoform X1
  KO
K05640  glial fibrillary acidic protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111170230 (GFAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111170230 (GFAP)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dle04812]
    111170230 (GFAP)
Membrane trafficking [BR:dle04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    111170230 (GFAP)
Cytoskeleton proteins [BR:dle04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     111170230 (GFAP)
SSDB
Motif
Pfam: Filament Filament_head DUF1664 Spc7
Other DBs
NCBI-GeneID: 111170230
NCBI-ProteinID: XP_022420904
UniProt: A0A2Y9MF64
LinkDB
Position
Unknown
AA seq 470 aa
MERRRVTSAARRSYVSSSEMGVGGRRLGPVTRLSLARMPPALPARVDFSLAGALNSSFKE
TRVSERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELR
LRLDQLTANSARLEVERDNLAQDLGTLRQKLQDETNLRLEAENNLAAYRQEADEATLGRL
DLERKTESLEEEIRFWRKIHEEEVRELQEQLAQQQVHVEMDVAKPDLTAALREIRTQYEA
VASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQALTCDLESLRGTNE
SLERQMREQDERHAREAASYLEALARLEEEGQSLKDEMARHLQEYQDLLSVKLALDIEIA
TYRKLLEGEENRITIPVQTFSNLQIRGGKSTKEGEGHKVTRHLKSLTIQVIPIQAHQIVN
GAPAGSALETSLDTNSVTEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggagaggagacgggtcacctcagcggctcgccgctcctatgtctcctcctcagagatg
ggggtggggggccgccgcctgggtcctgtcacccgcctgtccctggctcgaatgccgcct
gcactcccggcccgggtggacttctccttggccggggcgctcaactccagcttcaaggag
acccgggtcagtgagcgggcggagatgatggagctcaatgaccgcttcgccagctacatc
gagaaggtgcgcttcctggaacagcagaacaaggcgctggctgctgagctgaaccagctg
cgggccaaggagcccaccaagcttgccgacgtctaccaggcggagctgcgcgagctgcgg
ctgcggcttgatcaacttaccgccaacagcgcccggctcgaggtggagagggacaatctg
gcgcaggacctgggcaccctgaggcagaagctccaggatgaaaccaacctgaggctggag
gctgagaacaacctggctgcctatcgacaggaggcagatgaagccaccctgggccgtctg
gatctggagaggaagactgagtctctggaggaggaaatccggttctggaggaagatccat
gaggaggaggtgcgggagctccaggagcagctggctcagcagcaggtccacgtggagatg
gatgtggccaagcccgacctcacagcagccctgagagagatccgtacacagtacgaggca
gtggcatccagcaacatgcatgaggcggaggagtggtaccgctccaagtttgcggacttg
acggacgccgctgcccgcaacgcggagctgctccgccaggccaagcacgaggccaacgac
taccggcgccagctgcaggccttaacctgcgacctggagtccttgcgcggcacgaacgag
tccctggagaggcagatgcgggagcaggacgagcgccacgcgcgggaggcggcgagttac
ctggaggcgctggcccggctggaagaggaggggcagagcctcaaggacgagatggcccgc
cacctgcaggagtaccaggacctgctcagcgttaaactggccctggatatcgagatcgcc
acctacaggaagctgctggagggcgaagagaaccgcatcaccattcctgtgcagaccttc
tccaacctgcagatccgagggggcaaaagcaccaaagaaggggaaggtcacaaggtcaca
agacatctcaaaagcctcacaatacaggttataccaatacaggctcaccagattgtaaat
ggagcccccgccggctcggctctcgaaaccagcctggacaccaattccgtgacagaaggc
cacctcaagaggaacatcgtggtgaagaccgtggagatgcgggacggagaggtcattaag
gagtccaagcaggagcacaaggatgtgatgtga

DBGET integrated database retrieval system