KEGG   Delphinapterus leucas (beluga whale): 111170280
Entry
111170280         CDS       T05885                                 

Gene name
IRF7
Definition
(RefSeq) interferon regulatory factor 7 isoform X1
  KO
K09447  interferon regulatory factor 7
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05164  Influenza A
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111170280 (IRF7)
   04621 NOD-like receptor signaling pathway
    111170280 (IRF7)
   04622 RIG-I-like receptor signaling pathway
    111170280 (IRF7)
   04623 Cytosolic DNA-sensing pathway
    111170280 (IRF7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111170280 (IRF7)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111170280 (IRF7)
   05160 Hepatitis C
    111170280 (IRF7)
   05164 Influenza A
    111170280 (IRF7)
   05162 Measles
    111170280 (IRF7)
   05168 Herpes simplex virus 1 infection
    111170280 (IRF7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111170280 (IRF7)
   05169 Epstein-Barr virus infection
    111170280 (IRF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111170280 (IRF7)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    111170280 (IRF7)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 111170280
NCBI-ProteinID: XP_022420974
UniProt: A0A2Y9MFD1
LinkDB
Position
Unknown
AA seq 473 aa
MAVAPDGGTPRVLFGDWLLGEVSSGRYEGLRWLDAARTRFRVPWKHFARKDLGEADSRIF
KAWAVARGRWPLRSSAGARPTAESALRASWKTNFRCALHCTRRFVMLQDNSGDPTDPHKV
YMVTPGPACGESPGIISQGEDKALEDAPPTRDGLAGLSPEPCAPSPAGDAGDLLIQALQQ
SCLEDHVLKAACGVEPIAPGAPDTGPPPAPWQPREAEPRTTASPSACTLMAGHLHVAGPT
CSQLGLHTLPSLGALDLTITYKGRTVLQEVVGRPSCVLLYGPPDVGGGASEHQRVAFPSP
AELPDQKQLHYTEKLLQHVAPGLQLELRGLRLWARRLGKCKVYWEVGGPLGSASSSTPAR
LLPRNCDTPIFDFSTFFQELGEFEACRRRGSPHYTIYLGFGQDLSVGRPKEKSLVLVKLE
PWLCRAYLEGVQREGASSLDSGSLSLCLSSCNSLYDDLEHFLEHFLMEAEQPG
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggccgtggctcccgacggggggaccccgcgcgtgctcttcggagactggcttctgggc
gaggtcagcagcggccgctacgagggactacggtggctggacgcggcccgaacgcgcttc
cgcgtgccctggaagcactttgcgcggaaggacctgggagaggccgactcgcgcatcttc
aaggcctgggctgtggcccgcggcaggtggcctctccgcagcagcgcaggtgcccggccg
accgccgagagtgcgctccgagcttcctggaaaaccaacttccgctgcgcgctgcattgt
acgcggcgcttcgtgatgttgcaagacaactcgggggaccctaccgaccctcataaggtg
tacatggtcacccccgggccggcgtgcggagaaagcccaggcattattagccagggggag
gacaaggcccttgaagatgccccacctacaagggatgggctggccgggctgagccctgag
ccctgtgccccaagcccagccggagatgctggggacctactgatccaggctctgcagcag
agctgcctggaggaccatgtgctgaaagctgcgtgtggggtggagccgatagcccctggg
gctcctgacacaggcccacccccagccccctggcagccccgagaggcggagccccgcacc
acagcctcccccagtgcctgcaccctgatggcagggcatctgcacgtggctggtcccacc
tgctcacagctcggtctgcacacactgcccagcttgggggccctggacttgaccatcacg
tacaagggccgaacagtgctgcaagaggtggtggggcgcccgagctgtgtgctcctgtat
ggcccccccgatgtaggtggtggggcttcagagcaccagcgagtagcctttcccagcccc
gccgagctgcccgaccagaagcagctccactacacagagaagctgctgcagcacgtagcc
cccggcctgcagctggaactgcggggtctcaggctgtgggcccggcgcctgggcaagtgt
aaggtctattgggaggtgggagggcccctgggctcggccagctcctccacccccgcccgc
ctgctgccccggaactgcgacacccccatctttgacttcagcaccttcttccaagaactg
ggggagtttgaggcctgccggcgccggggctcccctcactacaccatctatctgggcttt
gggcaggacctgtcagtgggaaggcccaaggagaagagcctggtcctggtgaagttggaa
ccatggctgtgccgggcatacctggagggtgtgcagcgcgaaggcgcgtcctctctggac
agcggcagcctcagcctctgcctttccagctgcaacagcctctatgatgacctggagcac
ttcctggagcacttcctgatggaggcggagcagcctggctag

KEGG   Delphinapterus leucas (beluga whale): 111180609
Entry
111180609         CDS       T05885                                 

Gene name
IRF3
Definition
(RefSeq) interferon regulatory factor 3 isoform X1
  KO
K05411  interferon regulatory factor 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle05133  Pertussis
dle05135  Yersinia infection
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111180609 (IRF3)
   04621 NOD-like receptor signaling pathway
    111180609 (IRF3)
   04622 RIG-I-like receptor signaling pathway
    111180609 (IRF3)
   04623 Cytosolic DNA-sensing pathway
    111180609 (IRF3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111180609 (IRF3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111180609 (IRF3)
   05133 Pertussis
    111180609 (IRF3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111180609 (IRF3)
   05161 Hepatitis B
    111180609 (IRF3)
   05160 Hepatitis C
    111180609 (IRF3)
   05171 Coronavirus disease - COVID-19
    111180609 (IRF3)
   05164 Influenza A
    111180609 (IRF3)
   05162 Measles
    111180609 (IRF3)
   05168 Herpes simplex virus 1 infection
    111180609 (IRF3)
   05163 Human cytomegalovirus infection
    111180609 (IRF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111180609 (IRF3)
   05169 Epstein-Barr virus infection
    111180609 (IRF3)
   05165 Human papillomavirus infection
    111180609 (IRF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111180609 (IRF3)
   04131 Membrane trafficking [BR:dle04131]
    111180609 (IRF3)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    111180609 (IRF3)
Membrane trafficking [BR:dle04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    111180609 (IRF3)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 111180609
NCBI-ProteinID: XP_022440765
UniProt: A0A2Y9P3N5
LinkDB
Position
Unknown
AA seq 464 aa
MGTQKPRILPWLVSQLDQGQLEGVAWLDESRTRFRIPWKHGLRQDAQLEDFGIFQAWAEA
SGAYTPGKDKPDLPTWKRNFRSALNRKEALRLAEDHSKDPHNPHKIYEFVTSGVGNLAEP
DTSLDTNGRCSTSDIQEDILEKLLGDMDLAPDGGPSSLTMAPENPPQLLLGPNLDVPAPC
PKPGPPENPLKQLLESEEEWEFEVTVFYRGCQVFQQTVFCPGGLRLVGSEAGDRTLPGQP
IRLPDPAASLTDRGVTDYVQRVLSCLGGGLALWRAGQWLWAQRLGHCHVYWAVGEELLPN
SGHRPDGEVPKDREGGVFNMGPFIADLIAFIEGSGRSPRYTLWFCVGQSWPQDQPWVKRL
VMVKTSTRPTSRTWSRTWTSRSLGRPEPSTSTSTNKLAPAMVITYLSGVHCPWASPDPSW
GLFLLKARLSICASHSYPRCSLHKGQALCRGQLTLLTSSLWPGE
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgggaacacaaaagcctcgcatcctgccctggctggtatctcagctggaccaggggcag
ttggagggcgtggcctggctggatgaaagccgcacgcgcttccgcatcccttggaagcac
ggcttgcggcaggatgcccagctggaggacttcggcattttccaggcctgggctgaggcc
agtggtgcctacactcctgggaaggataagccggacctgcccacctggaagaggaatttc
cggtccgccctgaaccggaaggaagcgttgcgtttagcagaggaccacagcaaggacccc
cacaacccgcacaagatctatgagtttgtgacctcaggagttgggaacttagctgagcca
gacacctctctagacaccaatggcagatgcagtacctctgatatccaggaagacattctg
gagaagttactgggtgacatggacttggccccagatggagggccctcaagtctgaccatg
gcccctgagaacccccctcagctcttgctgggccccaacttagatgtccctgctccttgc
ccaaagccgggaccccctgaaaacccactgaagcagctgttggagagcgaggaagagtgg
gagttcgaggtgaccgtcttctaccggggctgccaagtcttccagcagactgtcttctgc
ccggggggcctgcggctggtgggatcagaagcaggggacaggacactgcctgggcagcca
ataagactgccagaccccgcggcgtccctgacagacaggggcgtgacagactacgtgcag
cgggtgctgagctgcctgggcgggggactagctctgtggagggctgggcagtggctctgg
gcccagaggctggggcactgccatgtgtactgggccgtgggcgaggaactcctccccaac
agtggtcacaggcctgatggtgaggtgcccaaggacagggaaggaggcgtgttcaacatg
gggcccttcatagcagatctgattgccttcatcgaaggaagcggacgctcaccacgctac
accctctggttctgcgtggggcagtcatggccccaggaccaaccatgggtcaagaggctc
gtgatggtcaagaccagtacaaggcctacctccaggacctggtcgaggacatggacttct
aggtcactggggaggcctgagccctcaacttccacctcaaccaataaactggctccggct
atggtcatcacttatctgtctggtgttcactgtccctgggccagccctgacccaagttgg
gggttattccttcttaaggcccgtttatccatctgtgcaagccactcatatcctaggtgc
tcactgcataaaggccaggcactgtgcagggggcagctgacactcctcacctcttccctg
tggcctggtgagtag

DBGET integrated database retrieval system