KEGG   Delphinapterus leucas (beluga whale): 111170386
Entry
111170386         CDS       T05885                                 

Gene name
RALB
Definition
(RefSeq) ras-related protein Ral-B
  KO
K07835  Ras-related protein Ral-B
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04072  Phospholipase D signaling pathway
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111170386 (RALB)
   04015 Rap1 signaling pathway
    111170386 (RALB)
   04072 Phospholipase D signaling pathway
    111170386 (RALB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111170386 (RALB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111170386 (RALB)
   05212 Pancreatic cancer
    111170386 (RALB)
Membrane trafficking [BR:dle04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    111170386 (RALB)
GTP-binding proteins [BR:dle04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    111170386 (RALB)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase SRPRB GTP_EFTU MMR_HSR1 Gtr1_RagA AAA_25 FeoB_N AAA_24
Other DBs
NCBI-GeneID: 111170386
NCBI-ProteinID: XP_022421209
UniProt: A0A2Y9MG03
LinkDB
Position
Unknown
AA seq 206 aa
MAANKSKSQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDK
VPLLVAGNKSDLQERRQVPLEEARAKAEEWGVQYVETSAKTRANVDKVFFDLMREIRAKK
MSENKDKNGKKSSKNKKSFKERCCLL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggccgcaaacaagagcaagagccagagctccctggcccttcacaaggtgatcatggtt
ggcagcggaggggtgggcaagtcggccctgaccttgcagttcatgtatgatgagttcgtg
gaggactatgaacctaccaaggctgacagttacaggaagaaggtggtcctggacggggag
gaggtccagatagacatcctggacacagccggacaggaggactacgcggccattcgcgac
aactacttccggagtggggagggcttcctcctcgtgttttccatcaccgagcatgagtca
ttcacagccactgccgagttcagggaacagatcctccgcgttaaggcggaagaagataaa
gtcccgctgctggtggcggggaacaagtctgacctgcaggagcggaggcaggtgccgctg
gaggaggccagggccaaggccgaggagtggggcgtgcagtacgtggagacctcggccaag
acgcgggccaacgtggacaaggtgttctttgacctcatgagagagatcagagcaaagaag
atgtcagaaaacaaagacaagaacggcaagaaaagcagcaagaacaagaaaagttttaaa
gaaagatgttgtttactgtga

KEGG   Delphinapterus leucas (beluga whale): 111184488
Entry
111184488         CDS       T05885                                 

Gene name
RALA
Definition
(RefSeq) ras-related protein Ral-A
  KO
K07834  Ras-related protein Ral-A
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04072  Phospholipase D signaling pathway
dle05132  Salmonella infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111184488 (RALA)
   04015 Rap1 signaling pathway
    111184488 (RALA)
   04072 Phospholipase D signaling pathway
    111184488 (RALA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111184488 (RALA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111184488 (RALA)
   05212 Pancreatic cancer
    111184488 (RALA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111184488 (RALA)
Membrane trafficking [BR:dle04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    111184488 (RALA)
GTP-binding proteins [BR:dle04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    111184488 (RALA)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 AAA_25 MMR_HSR1_Xtn ThiF ATP_bind_1
Other DBs
NCBI-GeneID: 111184488
NCBI-ProteinID: XP_022448747
UniProt: A0A2Y9PZK3
LinkDB
Position
Unknown
AA seq 206 aa
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
PFLLVGNKSDLEDKRQVSVEEAKTRADQWNVNYVETSAKTRANVDKVFFDLMREIRARKM
EDSKEKNGKKKRKSLAKRIRERCCIL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgcaaataagccgaagggtcagaattctttggccttacacaaagtcatcatggta
ggcagtggtggtgtgggcaagtctgctctgaccctgcagttcatgtacgatgagtttgtg
gaggactacgagcctaccaaggccgacagctaccggaagaaggtggtgctggacggggag
gaagtgcagatcgacatcttggacacagccgggcaggaggactacgccgccatcagggac
aactacttccggagcggcgagggcttcctctgtgtcttctccattacggaaatggagtcc
ttcgcggccacagccgacttcagggagcagattttaagagtaaaagaagatgagaatgtt
ccatttctgctcgttggaaacaaatcagatttggaagataaaaggcaggtttctgtagaa
gaggcaaaaaccagagccgatcagtggaatgttaactatgtggaaacatctgctaaaacg
cgagctaatgttgacaaggtattttttgatttaatgagggaaattcgagccagaaagatg
gaagacagcaaagaaaagaatgggaaaaagaagaggaaaagtttagccaagagaataaga
gaaagatgctgcattttataa

DBGET integrated database retrieval system