KEGG   Delphinapterus leucas (beluga whale): 111170524
Entry
111170524         CDS       T05885                                 

Gene name
STK11
Definition
(RefSeq) serine/threonine-protein kinase STK11 isoform X1
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04068  FoxO signaling pathway
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04530  Tight junction
dle04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111170524 (STK11)
   04151 PI3K-Akt signaling pathway
    111170524 (STK11)
   04152 AMPK signaling pathway
    111170524 (STK11)
   04150 mTOR signaling pathway
    111170524 (STK11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111170524 (STK11)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111170524 (STK11)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111170524 (STK11)
  09149 Aging
   04211 Longevity regulating pathway
    111170524 (STK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111170524 (STK11)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111170524 (STK11)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   111170524 (STK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 111170524
NCBI-ProteinID: XP_022421428
UniProt: A0A2Y9MW56
LinkDB
Position
Unknown
AA seq 544 aa
MEVADPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLVDGLEYLHSQGIVHKDIKPG
NLLLTTGGTLKISDLGVAEVGAPTPKPGPGLLTTGGTLKISDLGVAEALHPFAEDDTCRT
SQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGDY
TIPGDCGPPLSDLLKGMLEYEPAKRFSIQQIRQHSWFRKKHPPAEEPVPIPPSADCKDRW
RGMTVVPYLEDLHGCADAADDELFDIEDDIIYTQDFTVPGPGGGGWAERTEPGPAQSHVC
EWHRVSPVERQVEGRAPGQCRLQPRPQGLLGQQQDSPAVSLQAAVRVAACSLSPGAPARS
CSVFPPTAGLLLTAQEGRRCTLRADCPSGSRRVLEGCGWGTAGTGVRPPLVAGGHDLLLT
AILC
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggaggtggcggacccgcagcagctgggcatgtttacagagggcgagctgatgtcggtg
gggatggacacgttcatccaccgcatcgactccaccgaggtcatctaccagccccgccgc
aagcgggccaagctcatcggcaagtacctgatgggggacctgctgggggaggggtcgtac
ggcaaggtgaaggaggtgctggactcggagacgctgtgccggagagccgtcaaaattctc
aagaagaagaagttgcggaggatccccaacggggaggccaacgtaaagaaggaaatccag
ctgctgaggaggttacggcacaaaaacgtcatccagctggtggacgtgctgtacaacgag
gagaagcagaagatgtatatggtgatggagtactgcgtgtgcggcatgcaggagatgctg
gacagcgtgcccgagaagcgcttccccgtgtgccaggcccacgggtacttctgccagctg
gtggacggcctggagtacctgcacagccagggcatcgtgcacaaggacatcaagcccggc
aacctgctgctcaccacgggtggcacgctcaagatctccgacctgggcgtggccgaggta
ggtgcccccacccccaagccgggcccagggttgctcaccacgggtggcacgctcaagatc
tccgacctgggcgtggccgaggccctgcacccgtttgccgaggacgacacgtgccggacg
agccagggttcccccgcgttccagccgcccgagatcgccaatggcctggacaccttctct
ggcttcaaggtggacatctggtcagctggggtcacactctacaacatcacgacaggcctg
tacccattcgagggggacaatatctacaagctgtttgagaacatcgggaagggggactac
accatcccgggggattgtggccccccactctcagacctgctcaaagggatgctggaatac
gagccggccaagcggttttccatacagcagatccggcagcacagctggttccggaagaag
cacccgccagccgaggagccggtgcccatcccgccgagtgcggactgcaaggaccggtgg
cgcggcatgacagtggtaccctacctggaggacttgcacggctgtgccgacgctgcggat
gacgagctcttcgacattgaggacgacatcatctacactcaggacttcacggtgcccggt
cccggaggaggaggctgggcggagcgcacagagccggggcccgcccaaagccatgtgtgt
gaatggcaccgagtcagcccagttgagcgccaggtcgagggcagagcgccgggccagtgc
cgcctccaaccccgcccgcaaggcctgctcggccagcagcaagattcgccggctgtcagc
ctgcaagcagcagtgagggtggccgcctgcagcctgtctccaggagccccggccaggtcc
tgctcagtcttcccgccgactgctggcctgctgctcactgcccaggaaggccgccgctgc
acccttcgtgctgactgcccctccggaagccggagggtcctggagggctgtggttggggg
acagcagggactggggtccgccctcccttggtggccggtggacatgacctcctgctgact
gcaatcctgtgctga

DBGET integrated database retrieval system