Delphinapterus leucas (beluga whale): 111170657 Help Entry 111170657         CDS       T05885                                  Gene name TNF Definition (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle01523   Antifolate resistance dle04010   MAPK signaling pathway dle04060   Cytokine-cytokine receptor interaction dle04061   Viral protein interaction with cytokine and cytokine receptor dle04064   NF-kappa B signaling pathway dle04071   Sphingolipid signaling pathway dle04150   mTOR signaling pathway dle04210   Apoptosis dle04217   Necroptosis dle04350   TGF-beta signaling pathway dle04380   Osteoclast differentiation dle04612   Antigen processing and presentation dle04620   Toll-like receptor signaling pathway dle04621   NOD-like receptor signaling pathway dle04622   RIG-I-like receptor signaling pathway dle04625   C-type lectin receptor signaling pathway dle04640   Hematopoietic cell lineage dle04650   Natural killer cell mediated cytotoxicity dle04657   IL-17 signaling pathway dle04660   T cell receptor signaling pathway dle04664   Fc epsilon RI signaling pathway dle04668   TNF signaling pathway dle04920   Adipocytokine signaling pathway dle04930   Type II diabetes mellitus dle04931   Insulin resistance dle04932   Non-alcoholic fatty liver disease dle04933   AGE-RAGE signaling pathway in diabetic complications dle04940   Type I diabetes mellitus dle05010   Alzheimer disease dle05014   Amyotrophic lateral sclerosis dle05020   Prion disease dle05022   Pathways of neurodegeneration - multiple diseases dle05132   Salmonella infection dle05133   Pertussis dle05134   Legionellosis dle05135   Yersinia infection dle05140   Leishmaniasis dle05142   Chagas disease dle05143   African trypanosomiasis dle05144   Malaria dle05145   Toxoplasmosis dle05146   Amoebiasis dle05152   Tuberculosis dle05160   Hepatitis C dle05161   Hepatitis B dle05163   Human cytomegalovirus infection dle05164   Influenza A dle05165   Human papillomavirus infection dle05166   Human T-cell leukemia virus 1 infection dle05168   Herpes simplex virus 1 infection dle05169   Epstein-Barr virus infection dle05170   Human immunodeficiency virus 1 infection dle05171   Coronavirus disease - COVID-19 dle05205   Proteoglycans in cancer dle05310   Asthma dle05321   Inflammatory bowel disease dle05322   Systemic lupus erythematosus dle05323   Rheumatoid arthritis dle05330   Allograft rejection dle05332   Graft-versus-host disease dle05410   Hypertrophic cardiomyopathy dle05414   Dilated cardiomyopathy dle05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111170657 (TNF)    04350 TGF-beta signaling pathway     111170657 (TNF)    04064 NF-kappa B signaling pathway     111170657 (TNF)    04668 TNF signaling pathway     111170657 (TNF)    04071 Sphingolipid signaling pathway     111170657 (TNF)    04150 mTOR signaling pathway     111170657 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111170657 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     111170657 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     111170657 (TNF)    04217 Necroptosis     111170657 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     111170657 (TNF)    04620 Toll-like receptor signaling pathway     111170657 (TNF)    04621 NOD-like receptor signaling pathway     111170657 (TNF)    04622 RIG-I-like receptor signaling pathway     111170657 (TNF)    04625 C-type lectin receptor signaling pathway     111170657 (TNF)    04650 Natural killer cell mediated cytotoxicity     111170657 (TNF)    04612 Antigen processing and presentation     111170657 (TNF)    04660 T cell receptor signaling pathway     111170657 (TNF)    04657 IL-17 signaling pathway     111170657 (TNF)    04664 Fc epsilon RI signaling pathway     111170657 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     111170657 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     111170657 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     111170657 (TNF)   09163 Immune disease    05310 Asthma     111170657 (TNF)    05322 Systemic lupus erythematosus     111170657 (TNF)    05323 Rheumatoid arthritis     111170657 (TNF)    05321 Inflammatory bowel disease     111170657 (TNF)    05330 Allograft rejection     111170657 (TNF)    05332 Graft-versus-host disease     111170657 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     111170657 (TNF)    05014 Amyotrophic lateral sclerosis     111170657 (TNF)    05020 Prion disease     111170657 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     111170657 (TNF)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     111170657 (TNF)    05410 Hypertrophic cardiomyopathy     111170657 (TNF)    05414 Dilated cardiomyopathy     111170657 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     111170657 (TNF)    04940 Type I diabetes mellitus     111170657 (TNF)    04932 Non-alcoholic fatty liver disease     111170657 (TNF)    04931 Insulin resistance     111170657 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     111170657 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     111170657 (TNF)    05135 Yersinia infection     111170657 (TNF)    05133 Pertussis     111170657 (TNF)    05134 Legionellosis     111170657 (TNF)    05152 Tuberculosis     111170657 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     111170657 (TNF)    05170 Human immunodeficiency virus 1 infection     111170657 (TNF)    05161 Hepatitis B     111170657 (TNF)    05160 Hepatitis C     111170657 (TNF)    05171 Coronavirus disease - COVID-19     111170657 (TNF)    05164 Influenza A     111170657 (TNF)    05168 Herpes simplex virus 1 infection     111170657 (TNF)    05163 Human cytomegalovirus infection     111170657 (TNF)    05169 Epstein-Barr virus infection     111170657 (TNF)    05165 Human papillomavirus infection     111170657 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     111170657 (TNF)    05144 Malaria     111170657 (TNF)    05145 Toxoplasmosis     111170657 (TNF)    05140 Leishmaniasis     111170657 (TNF)    05142 Chagas disease     111170657 (TNF)    05143 African trypanosomiasis     111170657 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     111170657 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:dle04052]     111170657 (TNF)    00536 Glycosaminoglycan binding proteins [BR:dle00536]     111170657 (TNF) Cytokines and growth factors [BR:dle04052]  Cytokines   Tumor necrosis fators    111170657 (TNF) Glycosaminoglycan binding proteins [BR:dle00536]  Heparan sulfate / Heparin   Cytokines    111170657 (TNF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  111170657 NCBI-ProteinID:  XP_022421815 UniProt:  A0A2Y9MIH6 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSTESMIRDVELAEEALSKTAGGSQGSGRCLCLSLFSFFLVAGGTTLFCLLHFGVIGPQR EEFPTGYSIISPLAQTLRSSSKTSSNKPVAHVVANLSAQGQLRWLNTYANTLLANSVKLE DNQLVVPTDGLYLIYSQVLFRGQGCPSTHLFLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggatgtggagctggcagaggaggcgctctccaagacg gcagggggctcccagggttccggaaggtgcttgtgtctcagcctcttctccttcttcctg gtcgcaggaggcaccacgctcttctgcctgctgcacttcggggtaatcggcccccagagg gaagagttcccaactggctactccatcatcagccctctggctcagacactcagatcatct tctaaaacctcaagtaacaagcccgtagcccatgttgtagccaacctcagtgctcagggg cagctccggtggctgaacacatatgccaacaccctcctggccaacagcgtgaagctggaa gacaaccagctggtggtgccgacggacgggctgtacctcatctactcccaggtcctcttc aggggccaaggctgcccttccacccacttgttcctcacccacaccatcagccgcatcgct gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccagagggag acgccagagggggctgaggccaagccctggtatgagcccatctaccagggaggggtcttc cagctggagaagggtgatcgactcagtgctgagatcaacctgcccgactatctggacttt gctgagtctgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system