KEGG   Delphinapterus leucas (beluga whale): 111170657
Entry
111170657         CDS       T05885                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01523  Antifolate resistance
dle04010  MAPK signaling pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04064  NF-kappa B signaling pathway
dle04071  Sphingolipid signaling pathway
dle04150  mTOR signaling pathway
dle04210  Apoptosis
dle04217  Necroptosis
dle04350  TGF-beta signaling pathway
dle04380  Osteoclast differentiation
dle04612  Antigen processing and presentation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04640  Hematopoietic cell lineage
dle04650  Natural killer cell mediated cytotoxicity
dle04657  IL-17 signaling pathway
dle04660  T cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04668  TNF signaling pathway
dle04920  Adipocytokine signaling pathway
dle04930  Type II diabetes mellitus
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04940  Type I diabetes mellitus
dle05010  Alzheimer disease
dle05014  Amyotrophic lateral sclerosis
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05133  Pertussis
dle05134  Legionellosis
dle05135  Yersinia infection
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05143  African trypanosomiasis
dle05144  Malaria
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05205  Proteoglycans in cancer
dle05310  Asthma
dle05321  Inflammatory bowel disease
dle05322  Systemic lupus erythematosus
dle05323  Rheumatoid arthritis
dle05330  Allograft rejection
dle05332  Graft-versus-host disease
dle05410  Hypertrophic cardiomyopathy
dle05414  Dilated cardiomyopathy
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111170657 (TNF)
   04350 TGF-beta signaling pathway
    111170657 (TNF)
   04064 NF-kappa B signaling pathway
    111170657 (TNF)
   04668 TNF signaling pathway
    111170657 (TNF)
   04071 Sphingolipid signaling pathway
    111170657 (TNF)
   04150 mTOR signaling pathway
    111170657 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111170657 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111170657 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111170657 (TNF)
   04217 Necroptosis
    111170657 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111170657 (TNF)
   04620 Toll-like receptor signaling pathway
    111170657 (TNF)
   04621 NOD-like receptor signaling pathway
    111170657 (TNF)
   04622 RIG-I-like receptor signaling pathway
    111170657 (TNF)
   04625 C-type lectin receptor signaling pathway
    111170657 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    111170657 (TNF)
   04612 Antigen processing and presentation
    111170657 (TNF)
   04660 T cell receptor signaling pathway
    111170657 (TNF)
   04657 IL-17 signaling pathway
    111170657 (TNF)
   04664 Fc epsilon RI signaling pathway
    111170657 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111170657 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111170657 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111170657 (TNF)
  09163 Immune disease
   05310 Asthma
    111170657 (TNF)
   05322 Systemic lupus erythematosus
    111170657 (TNF)
   05323 Rheumatoid arthritis
    111170657 (TNF)
   05321 Inflammatory bowel disease
    111170657 (TNF)
   05330 Allograft rejection
    111170657 (TNF)
   05332 Graft-versus-host disease
    111170657 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111170657 (TNF)
   05014 Amyotrophic lateral sclerosis
    111170657 (TNF)
   05020 Prion disease
    111170657 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    111170657 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111170657 (TNF)
   05410 Hypertrophic cardiomyopathy
    111170657 (TNF)
   05414 Dilated cardiomyopathy
    111170657 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111170657 (TNF)
   04940 Type I diabetes mellitus
    111170657 (TNF)
   04932 Non-alcoholic fatty liver disease
    111170657 (TNF)
   04931 Insulin resistance
    111170657 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111170657 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111170657 (TNF)
   05135 Yersinia infection
    111170657 (TNF)
   05133 Pertussis
    111170657 (TNF)
   05134 Legionellosis
    111170657 (TNF)
   05152 Tuberculosis
    111170657 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111170657 (TNF)
   05170 Human immunodeficiency virus 1 infection
    111170657 (TNF)
   05161 Hepatitis B
    111170657 (TNF)
   05160 Hepatitis C
    111170657 (TNF)
   05171 Coronavirus disease - COVID-19
    111170657 (TNF)
   05164 Influenza A
    111170657 (TNF)
   05168 Herpes simplex virus 1 infection
    111170657 (TNF)
   05163 Human cytomegalovirus infection
    111170657 (TNF)
   05169 Epstein-Barr virus infection
    111170657 (TNF)
   05165 Human papillomavirus infection
    111170657 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111170657 (TNF)
   05144 Malaria
    111170657 (TNF)
   05145 Toxoplasmosis
    111170657 (TNF)
   05140 Leishmaniasis
    111170657 (TNF)
   05142 Chagas disease
    111170657 (TNF)
   05143 African trypanosomiasis
    111170657 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    111170657 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111170657 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111170657 (TNF)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Tumor necrosis fators
   111170657 (TNF)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Cytokines
   111170657 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 111170657
NCBI-ProteinID: XP_022421815
UniProt: A0A2Y9MIH6
LinkDB
Position
Unknown
AA seq 233 aa
MSTESMIRDVELAEEALSKTAGGSQGSGRCLCLSLFSFFLVAGGTTLFCLLHFGVIGPQR
EEFPTGYSIISPLAQTLRSSSKTSSNKPVAHVVANLSAQGQLRWLNTYANTLLANSVKLE
DNQLVVPTDGLYLIYSQVLFRGQGCPSTHLFLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggatgtggagctggcagaggaggcgctctccaagacg
gcagggggctcccagggttccggaaggtgcttgtgtctcagcctcttctccttcttcctg
gtcgcaggaggcaccacgctcttctgcctgctgcacttcggggtaatcggcccccagagg
gaagagttcccaactggctactccatcatcagccctctggctcagacactcagatcatct
tctaaaacctcaagtaacaagcccgtagcccatgttgtagccaacctcagtgctcagggg
cagctccggtggctgaacacatatgccaacaccctcctggccaacagcgtgaagctggaa
gacaaccagctggtggtgccgacggacgggctgtacctcatctactcccaggtcctcttc
aggggccaaggctgcccttccacccacttgttcctcacccacaccatcagccgcatcgct
gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccagagggag
acgccagagggggctgaggccaagccctggtatgagcccatctaccagggaggggtcttc
cagctggagaagggtgatcgactcagtgctgagatcaacctgcccgactatctggacttt
gctgagtctgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system