KEGG   Delphinapterus leucas (beluga whale): 111170864
Entry
111170864         CDS       T05885                                 

Definition
(RefSeq) recombining binding protein suppressor of hairless isoform X1
  KO
K06053  recombining binding protein suppressor of hairless
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04330  Notch signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle05017  Spinocerebellar ataxia
dle05165  Human papillomavirus infection
dle05169  Epstein-Barr virus infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    111170864
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111170864
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111170864
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    111170864
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111170864
   05165 Human papillomavirus infection
    111170864
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111170864
Transcription factors [BR:dle03000]
 Eukaryotic type
  Other transcription factors
   Others
    111170864
SSDB
Motif
Pfam: BTD LAG1-DNAbind TIG RHD_dimer
Other DBs
NCBI-GeneID: 111170864
NCBI-ProteinID: XP_022422159
UniProt: A0A2Y9MJ12
LinkDB
Position
Unknown
AA seq 500 aa
MYQMEGSPAEEPPAHAPSLGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSY
GNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGK
NYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLC
IASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFYIHLLDDDESEGEEFTVRDG
YIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCL
SQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESL
QLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGS
YTNVSTNSTNVTSSTATVVS
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgtaccagatggagggctcgcccgcggaggagccgcctgcgcatgctccatctcttgga
aaatttggtgagcggcctccacctaaacgacttactagggaagctatgcgaaattattta
aaagagcgaggggatcaaacagtacttattcttcatgcaaaagttgcacagaagtcatat
ggaaatgaaaaaaggttcttttgccctcctccttgtgtatatcttatgggcagtggatgg
aagaaaaaaaaagaacaaatggaacgcgatggttgttctgaacaagagtctcaaccatgt
gcatttattggaataggaaatagtgaccaagaaatgcagcagctgaacttggaaggaaag
aactattgcacggccaaaacattgtatatatctgattcagacaagagaaagcacttcatg
ctctctgtaaagatgttctatggcaatagtgatgacattggtgtgttcctcagcaagcgg
ataaaagtcatctccaaaccttccaaaaagaagcagtcattgaaaaatgctgacttatgc
attgcctcaggaacaaaggtggctctgtttaatcgacttcgatcccagacagttagtacc
agatacttgcatgtagaaggaggtaatttccatgccagttctcagcagtggggagcattt
tacattcatctcttggatgacgatgaatcagaaggagaagaattcacagtccgcgatgga
tacatccattatggacaaacagtcaaacttgtgtgttcagttactggcatggcactccca
agattgataattaggaaagttgataagcagaccgcattactggatgcagatgatcctgtg
tcacagctccataaatgtgcattttaccttaaggatacagaaagaatgtacttgtgcctt
tctcaagaaagaataattcagtttcaggccactccatgcccaaaagaaccaaataaagag
atgataaatgatggcgcttcctggacaatcattagtacggataaggcagagtatacattt
tacgaggggatgggccctgtccttgccccagtcacaccggtgcctgttgtagaaagtctt
cagttgaatggcggtggggacgtagcaatgcttgaacttacaggacagaatttcactcca
aatttacgagtgtggtttggggatgtagaagctgaaactatgtacagatgtggagagagt
atgctctgtgttgtcccagacatttctgcattccgagaaggttggagatgggtccggcag
ccagtccaggttccagtaactttggtccgtaatgatggaatcatttattccaccagcctt
acctttacctacaccccagaaccggggccacggccacattgcagcgcggcgggagcaatc
cttcgagccaactctagccaagtgccccctaatgagtcaaacacaaacagcgaggggagt
tacacaaatgtcagcacaaattcaaccaatgtcacgtcatctacagcaacagttgtgtcc
taa

KEGG   Delphinapterus leucas (beluga whale): 111184415
Entry
111184415         CDS       T05885                                 

Gene name
RBPJL
Definition
(RefSeq) recombining binding protein suppressor of hairless-like protein
  KO
K06053  recombining binding protein suppressor of hairless
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04330  Notch signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle05017  Spinocerebellar ataxia
dle05165  Human papillomavirus infection
dle05169  Epstein-Barr virus infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    111184415 (RBPJL)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111184415 (RBPJL)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111184415 (RBPJL)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    111184415 (RBPJL)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111184415 (RBPJL)
   05165 Human papillomavirus infection
    111184415 (RBPJL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111184415 (RBPJL)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Other transcription factors
   Others
    111184415 (RBPJL)
SSDB
Motif
Pfam: BTD LAG1-DNAbind
Other DBs
NCBI-GeneID: 111184415
NCBI-ProteinID: XP_022448655
UniProt: A0A2Y9PSX2
LinkDB
Position
Unknown
AA seq 516 aa
MDPVGADPSAHPGPLTHLSLPDSSEARPQSGADGRSLPGSWTRSSPEPAAVLREGVRQCL
QQQCEQTVRILHAKVAQKSYGNEKRFFCPPPCVYLAGPGWRVKPVQGQAHQAGETGPIVC
GYMGLDGASGSAAETQKLNFEEQPDSREFGCAKTLYISDADKRKHFRLVLRLVLRGGREL
GTFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQTVSTRYLSVEDGDFVAS
ARQWAAFTLHLADEHCSQGDFPPREGYVHYGSLVQLICTVTGITLPPMIIRKVTKQCALL
DVDEPISQLHKCAFQFPGGPPGGGGTYLCLATEKVVQFQASPCPKEANKAVLNDSSCWTI
IGTESVEFSFSTSLACTREPVTPVPLISTLELSGGGDVATLELHGENLHAGLKVWFGEVE
AETMYRSPRSLVCVVPDIAAFGSDWRWLRTPITVPVSLVRADGLFYPSAFSFTYTPEYSV
RSGPPGASAPAADADALLESIHHEFTRTNFHLFIQT
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggaccctgtgggggcagacccctcagcgcacccaggccctctgactcacctaagcctg
ccggacagctcggaggcgcggccgcagagcggagccgacgggcggagcctcccgggcagt
tggaccaggtcatccccagagcccgccgcggtcctgagggaaggtgtgcgccagtgccta
cagcaacagtgcgagcagacggtgcggatcctgcacgccaaggtggcccagaaatcatat
ggaaatgagaagcggttcttctgccccccgccctgtgtctacctcgcaggtcccggatgg
agggtgaagccagtgcagggccaagcccaccaggcaggggagaccgggcccatcgtctgc
ggttacatgggactggacggcgcgtccggcagcgctgccgagacgcagaagttgaatttc
gaagagcagccggactccagggaattcggttgcgccaagaccctgtacatctcggacgca
gacaagaggaagcacttccggctggtgctgcggctagtgctccgaggggggcgagagctg
ggcactttccacagccgcctcatcaaggtcatctccaagccctcgcagaagaagcagtcg
ctgaaaaacaccgacctgtgcatatcctcgggctcaaaggtctccctcttcaaccgcctg
cgctcccagacggtctccacgcgctacctctctgtggaggatggggacttcgtggccagt
gcacgccagtgggctgccttcactctccacctggctgatgaacactgttcccagggagac
ttcccgcctcgagagggctatgtccactacggctccctggtgcagctgatctgcacagtc
acgggcatcacgctacctccaatgatcatccgcaaagtaactaaacagtgtgcgctcctc
gacgtggatgagcccatctcccagctgcacaagtgtgcattccagttcccaggtggtcct
ccaggagggggtggcacctacttatgtctcgccacagagaaggtggtgcagtttcaggcc
tccccctgccccaaggaggcgaacaaggcggtgctcaacgacagctcttgctggaccatc
atcggcaccgagtcagtggaattctccttcagcaccagcctggcgtgtacccgggagcct
gtcactccggtgcccctcatcagcaccctcgagctgagtggcgggggcgatgtggcaaca
ctggagctccacggtgaaaacctccacgcggggctcaaggtttggttcggggaagtggag
gccgaaaccatgtacaggagcccgcggtccctagtgtgcgtggtaccagacatagccgcc
ttcggcagcgactggcgctggctgcgcacacccatcacagtgcccgtgagcctcgtgcgt
gccgacggcctcttctaccccagcgccttctccttcacctacaccccggagtacagcgtg
cggtccgggcctccgggtgcctctgcgcccgccgctgatgctgatgcgctcctggagagc
atccatcacgaatttacacgcaccaacttccacctcttcatccagacgtag

DBGET integrated database retrieval system