KEGG   Delphinapterus leucas (beluga whale): 111170946
Entry
111170946         CDS       T05885                                 

Gene name
ATF6B
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04022  cGMP-PKG signaling pathway
dle04141  Protein processing in endoplasmic reticulum
dle04151  PI3K-Akt signaling pathway
dle04211  Longevity regulating pathway
dle04261  Adrenergic signaling in cardiomyocytes
dle04668  TNF signaling pathway
dle04728  Dopaminergic synapse
dle04911  Insulin secretion
dle04915  Estrogen signaling pathway
dle04918  Thyroid hormone synthesis
dle04925  Aldosterone synthesis and secretion
dle04926  Relaxin signaling pathway
dle04927  Cortisol synthesis and secretion
dle04928  Parathyroid hormone synthesis, secretion and action
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle05020  Prion disease
dle05030  Cocaine addiction
dle05031  Amphetamine addiction
dle05034  Alcoholism
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111170946 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111170946 (ATF6B)
   04022 cGMP-PKG signaling pathway
    111170946 (ATF6B)
   04151 PI3K-Akt signaling pathway
    111170946 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111170946 (ATF6B)
   04915 Estrogen signaling pathway
    111170946 (ATF6B)
   04926 Relaxin signaling pathway
    111170946 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    111170946 (ATF6B)
   04918 Thyroid hormone synthesis
    111170946 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    111170946 (ATF6B)
   04925 Aldosterone synthesis and secretion
    111170946 (ATF6B)
   04927 Cortisol synthesis and secretion
    111170946 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111170946 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    111170946 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    111170946 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111170946 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    111170946 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    111170946 (ATF6B)
   05031 Amphetamine addiction
    111170946 (ATF6B)
   05034 Alcoholism
    111170946 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111170946 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111170946 (ATF6B)
   05161 Hepatitis B
    111170946 (ATF6B)
   05163 Human cytomegalovirus infection
    111170946 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111170946 (ATF6B)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111170946 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 111170946
NCBI-ProteinID: XP_022422284
UniProt: A0A2Y9MJD1
LinkDB
Position
Unknown
AA seq 700 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDSTLYTGLDEVAEEQTRLFLCPEQDVPFGSSSL
DLGMDVSPPEPPWDSLPIFPDLQVKSEPSSPSSSSSLSSESSRLSAEPSSQASGVGEVLV
VKSESLTPSLCLLGDDPTSPFETVQINVGPTSDDASDVQIKIEPVSPSSSINSEASLLSA
ESPNQAFIGEEVLEVKTESPSPQGCLLRDVSGPPLGAVQISMGLSSDGSSGKPLPARKPP
LQPKPVVITTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQPEGLTPPAPRPE
RKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLAD
NQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPPPAP
ISPRMSREEPRPQRHLLEFSAQEPVHRVEHPQHPSQGPKETQPSSTGQPSFRNLTAFPGG
TKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKMPQRPQERQKSQLW
KKSPPVKAVPTQPPGPPERDAVGQLQLYRQPDRSQPEFLDAIDRREDTFYVVSFRRDHLL
LPAISHNKTSRPKMSLVMPAMAPNETVSGRGPPGDYEEMMQIECEVMDTRVIHIKTSTVP
PSLRKQPSSSPGNATGGPLPASAASQAHQAARQPXYLNHP
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctcctcagcgagattgcggacccgacgcgctttttcaccgacaat
ttgctgagcccggaggactgggacagcaccttatacaccggcctggatgaagtggccgag
gagcagacgcggctcttcctttgcccggagcaggatgtcccgtttggcagcagttccctg
gacttggggatggatgtcagccctcctgaacccccctgggactctctgcctatcttccca
gatcttcaggtgaagtctgagccatcctccccctcctcttcctcctccctcagctctgaa
tcctcgcgcctttctgcagagccctccagccaggcctctggtgtaggggaggtgctggtc
gtgaagtcagagtccttgacaccctcactctgcctcttgggagatgatccaacatcccca
tttgaaaccgtccagatcaatgtgggccccacctctgatgatgcctcagatgtccagatt
aagatagagcctgtctctccatcttcctccatcaactcagaggcttccctgctctctgcg
gagtcccccaaccaggcttttataggagaggaggtactggaagtgaagacagagtcccca
tcccctcaagggtgtctcttgcgggatgtctcaggccccccacttggagctgtccagatc
agcatgggcctgtcctctgatggctcctcaggcaaacccctgcccgcccggaagccacca
ctgcagcccaaacctgtggtgataaccactgtcccgatgccaccgagagctgtgcctccc
agcaccactgtccttttgcagccccttgtccagccacccccagtgtccccagttgttctc
atccaaggtgctattcgagtccagcctgagggactgaccccccctgctccacggcctgag
aggaagagcattgttccagctcctatgcctgggaactcctgcccgcctgaggtggatgca
aagctgctgaagcggcagcagcgaatgatcaagaaccgggagtcggcctgccagtcccgg
aggaagaagaaggagtatctgcaggggctggaagctcggctgcaggctgtgctggccgac
aaccagcagctccggcgggagaatgctgccctccgccggcggctggaggccctgctggct
gagaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcatcatggtcttc
cttctcttcattgccttcaactttgggcctgtcagcatcagtgagcctcctccagctccc
atctctcctcggatgagcagagaggagcctcgaccccagagacacttgctggagttctcg
gcgcaagagccagttcacagagtcgagcacccccagcatccctcccagggtcccaaggag
acccagcccagctccacgggccagccaagtttcaggaacctgacagccttccctgggggc
accaaggagctgctgctgagagacctggaccagctcttcctctcctctgattgccggcac
ttcaacagaaccgagtccctgaggcttgctgatgagctgagcggctgggtccagcgccac
cagagaggccggcggaagatgccccagaggccccaggagagacagaagtctcagctatgg
aagaagtcgcctccagttaaggcagtccccacccaaccccctgggcccccagaaagggat
gctgtgggccagctgcagctatatcgtcaaccagaccgttcgcagccagagttcctggat
gcaattgaccgacgggaagacacattttatgttgtctccttccgaagggaccacttgctg
ctcccagccatcagccacaacaagacctctcggcccaagatgtccctggtgatgcccgcc
atggcccccaatgagaccgtgtcaggccgggggcccccgggagactatgaggagatgatg
cagatcgagtgtgaggtcatggacaccagggtgatccacatcaagacctccacggtgccc
ccctcactccgaaaacagccgtcctcaagcccgggcaatgccacaggtggccccttgcca
gcttctgcagccagccaggcccaccaggccgcccgtcagcccntctacctcaatcatccc
tga

DBGET integrated database retrieval system