KEGG   Delphinapterus leucas (beluga whale): 111170969
Entry
111170969         CDS       T05885                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01523  Antifolate resistance
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04062  Chemokine signaling pathway
dle04064  NF-kappa B signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04380  Osteoclast differentiation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04625  C-type lectin receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04668  TNF signaling pathway
dle04920  Adipocytokine signaling pathway
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05212  Pancreatic cancer
dle05215  Prostate cancer
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05222  Small cell lung cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05340  Primary immunodeficiency
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111170969 (IKBKG)
   04014 Ras signaling pathway
    111170969 (IKBKG)
   04064 NF-kappa B signaling pathway
    111170969 (IKBKG)
   04668 TNF signaling pathway
    111170969 (IKBKG)
   04151 PI3K-Akt signaling pathway
    111170969 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111170969 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111170969 (IKBKG)
   04621 NOD-like receptor signaling pathway
    111170969 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    111170969 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    111170969 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    111170969 (IKBKG)
   04660 T cell receptor signaling pathway
    111170969 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    111170969 (IKBKG)
   04659 Th17 cell differentiation
    111170969 (IKBKG)
   04657 IL-17 signaling pathway
    111170969 (IKBKG)
   04662 B cell receptor signaling pathway
    111170969 (IKBKG)
   04062 Chemokine signaling pathway
    111170969 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111170969 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111170969 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111170969 (IKBKG)
   05203 Viral carcinogenesis
    111170969 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111170969 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111170969 (IKBKG)
   05221 Acute myeloid leukemia
    111170969 (IKBKG)
   05220 Chronic myeloid leukemia
    111170969 (IKBKG)
   05215 Prostate cancer
    111170969 (IKBKG)
   05222 Small cell lung cancer
    111170969 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    111170969 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111170969 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111170969 (IKBKG)
   05135 Yersinia infection
    111170969 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111170969 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    111170969 (IKBKG)
   05161 Hepatitis B
    111170969 (IKBKG)
   05160 Hepatitis C
    111170969 (IKBKG)
   05171 Coronavirus disease - COVID-19
    111170969 (IKBKG)
   05164 Influenza A
    111170969 (IKBKG)
   05162 Measles
    111170969 (IKBKG)
   05168 Herpes simplex virus 1 infection
    111170969 (IKBKG)
   05163 Human cytomegalovirus infection
    111170969 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111170969 (IKBKG)
   05169 Epstein-Barr virus infection
    111170969 (IKBKG)
   05165 Human papillomavirus infection
    111170969 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111170969 (IKBKG)
   05142 Chagas disease
    111170969 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    111170969 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111170969 (IKBKG)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111170969 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 ZapB Bacillus_HBL LLC1 zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 111170969
NCBI-ProteinID: XP_022422335
UniProt: A0A2Y9MTM9
LinkDB
Position
Unknown
AA seq 412 aa
MSRPPWKSPLCEMVQPSGGPAGDQDVLGEESSLGKPAMLHLPSEQAAPETFQRCLEENQE
LRDAIRQSNQMLRERCEELQRFQGSQREEKAFLMQKFQEARDLVERLSLEKRELHRQREQ
ALQEVERLKTCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEWQALEGRVRAASEQ
ARQLESEREALQQQHSVQVDQLRLQNQSMDAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDSHIKSSMGLQLEDLKQQLKQAEEALVAKQELIDKLKEEAEQHKTVMETVPVLKAQADI
YKADFQAERQAREKLAEKKEFLQAQLEQLQREHNRLKTSCQESARIEDMRKRHVEVSQPP
LAPAPAHHSFHLALPSQRRSPPEEPPNFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgagcaggcccccttggaagagtccactgtgtgagatggtgcagcctagtggcggcccg
gcaggggaccaggacgtgctgggtgaagagtcttctctggggaagccagccatgctccac
ctgccttcagagcaggctgctcctgagaccttccagcgctgtctggaggagaatcaagag
ctccgagatgccatccgccagagcaaccagatgctgcgggaacgctgcgaggagctgcag
cgtttccagggcagccagagggaggagaaggccttcctcatgcagaagttccaggaggcc
cgggacctggtggagaggctgagcctggagaagcgggagctgcaccggcagagggagcag
gccctgcaggaggtggagcgcctcaagacatgccagcagcagatggccgaggacaaggcc
tcagtgaaagcccaggtgacatccttgctgggggagctgcaggagagccagagtcgcttg
gaggccgccaccaaggagtggcaggctttggagggcagggtccgggctgccagcgagcag
gcccggcagctggagagcgagcgcgaggcgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcctgcagaaccagagcatggacgccgccctgcgcatggagcgccaggctgcc
tcggaggagaagaggaagctggcccagctgcaggtggcctatcaccagctcttccaagag
tatgacagccacatcaagagcagcatgggattgcagctggaagatctcaagcagcagctc
aagcaggcagaggaggccctggtggctaaacaggagctgatcgacaaactgaaggaagag
gctgagcaacacaagactgtgatggagacggttccggtgctgaaagcccaggcggatatc
tacaaggcggatttccaggctgagaggcaggcccgggagaagctggctgagaagaaggag
ttcctgcaggcgcagctggagcagctgcagagggagcacaacaggctgaagaccagctgt
caggagtcggccaggatcgaagacatgaggaagcggcatgtagaggtctcccagcccccc
ttagcccctgccccagctcatcactcctttcacctggccctgcccagccagaggagaagc
ccccctgaagagccgcccaacttctgctgccccaagtgccagtatcaggctcctgacatg
gacaccctgcagatacacgtcatggagtgcatcgagtag

KEGG   Delphinapterus leucas (beluga whale): 111172396
Entry
111172396         CDS       T05885                                 

Gene name
CHUK
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha isoform X1
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01523  Antifolate resistance
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04062  Chemokine signaling pathway
dle04064  NF-kappa B signaling pathway
dle04068  FoxO signaling pathway
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04380  Osteoclast differentiation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04625  C-type lectin receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04668  TNF signaling pathway
dle04920  Adipocytokine signaling pathway
dle05010  Alzheimer disease
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05212  Pancreatic cancer
dle05215  Prostate cancer
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05222  Small cell lung cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111172396 (CHUK)
   04014 Ras signaling pathway
    111172396 (CHUK)
   04064 NF-kappa B signaling pathway
    111172396 (CHUK)
   04668 TNF signaling pathway
    111172396 (CHUK)
   04068 FoxO signaling pathway
    111172396 (CHUK)
   04151 PI3K-Akt signaling pathway
    111172396 (CHUK)
   04150 mTOR signaling pathway
    111172396 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111172396 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111172396 (CHUK)
   04621 NOD-like receptor signaling pathway
    111172396 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    111172396 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    111172396 (CHUK)
   04625 C-type lectin receptor signaling pathway
    111172396 (CHUK)
   04660 T cell receptor signaling pathway
    111172396 (CHUK)
   04658 Th1 and Th2 cell differentiation
    111172396 (CHUK)
   04659 Th17 cell differentiation
    111172396 (CHUK)
   04657 IL-17 signaling pathway
    111172396 (CHUK)
   04662 B cell receptor signaling pathway
    111172396 (CHUK)
   04062 Chemokine signaling pathway
    111172396 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111172396 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111172396 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111172396 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111172396 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111172396 (CHUK)
   05221 Acute myeloid leukemia
    111172396 (CHUK)
   05220 Chronic myeloid leukemia
    111172396 (CHUK)
   05215 Prostate cancer
    111172396 (CHUK)
   05222 Small cell lung cancer
    111172396 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111172396 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111172396 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111172396 (CHUK)
   05135 Yersinia infection
    111172396 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111172396 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    111172396 (CHUK)
   05161 Hepatitis B
    111172396 (CHUK)
   05160 Hepatitis C
    111172396 (CHUK)
   05171 Coronavirus disease - COVID-19
    111172396 (CHUK)
   05164 Influenza A
    111172396 (CHUK)
   05162 Measles
    111172396 (CHUK)
   05168 Herpes simplex virus 1 infection
    111172396 (CHUK)
   05163 Human cytomegalovirus infection
    111172396 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111172396 (CHUK)
   05169 Epstein-Barr virus infection
    111172396 (CHUK)
   05165 Human papillomavirus infection
    111172396 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111172396 (CHUK)
   05142 Chagas disease
    111172396 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    111172396 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111172396 (CHUK)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     111172396 (CHUK)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111172396 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 111172396
NCBI-ProteinID: XP_022424767
UniProt: A0A2Y9N087
LinkDB
Position
Unknown
AA seq 744 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIMHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPIDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTCSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEMALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGVTPQASAWLPTTSAEREHPLSCVVTPQDGETLAQIIEENLNCLGHLS
TIMHEANEKQGNSMMNLDWSWLTE
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgggagcgg
ctgggcaccggcggcttcgggaatgtttgcctgtaccaacatcgggaacttgatctcaaa
atagcaattaagtcttgtcgcttggagctaagcaccaaaaacagagaacggtggtgccat
gaaatccagatcatgaagaagttgaaccacgccaatgttgtaaaggcctgtgatgttcct
gaggaattgaattttttgattaatgatgtgcctcttctagcaatggaatattgttctgga
ggagatctccggaagctactcaacaaaccagaaaattgctgtggacttaaagaaagccag
atactttctttactgagtgatataggatctgggatacgatatttgcatgaaaacaaaatt
atacatcgtgatctaaaacctgaaaacatagttcttcaggatgttggtggaaagattatg
cataaaataattgatttaggatatgccaaagatgttgatcaaggaagtctgtgtacatct
tttgtgggaacattgcaatatctggccccagagctctttgagaataagccttacacagcc
actgttgattattggagctttgggaccatggtgtttgagtgtattgctgggtataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgcgaagagatgacaggagaagttcggtttagtagccatttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaaaactggctacagttgatgcta
aactgggatcctcagcagagaggaggacctattgatcttactttgaagcagccaagatgt
tttgtattaatggatcacattctgaatttgaagatagtacacatcctaaatatgacttct
gcaaagatcatttcttttctgttaccacctgatgaaagtcttcattcactacagtctcgt
attgagcgtgaaactggaataaatacttgttctcaagagcttctttcagagacgggaatt
tctttggatcctcggaaaccagcctctcagtgtgttttggatggagttaggggctgtgat
agctatatggtttatttgtttgataaaagtaagactgtatatgaaggaccatttgcttcc
agaagtttatctgactgtgtaaattatattgtacaggacagcaaaatacagcttccaatt
atacagctgcgtaaagtatgggccgaagcagtgcactatgtgtctgggctaaaagaagac
tacagcaggctctttcagggacagagagcagcaatgttaagtcttcttagatataatgct
aacttgacaaaaatgaagaacactttaatctcagcatctcagcaactgaaagctaaattg
gagttttttcacaaaagcattcagcttgacttggaaagatatagtgagcagatgacttat
gggatatcctcagaaaaaatgttaaaagcatggaaagaaatggaagaaaaggctatccac
tatgctgaggtgggtgtcattggatacctggaggatcagataatgtccctgcacactgaa
atcatggagctacagaagagcccctatggacgacgtcagggagacttgatggaatctctg
gaacagcgtgccattgatctatataagcagttaaagcacagaccttcagatcactcctac
agcgacagcacggagatggtgaaaatcattgtgcatactgtgcagagtcaggaccgggtt
ctcaaggagctgttcggtcatttgagcaagttgttgggctgtaagcagaagattattgat
ctactgcccaaggtggaaatggccctcagtaacatcaaagaagctgacaatactgtcatg
tttatgcagggaaagaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agctctgctcggtcccttgtaggatccagtctagaaggtgtaacccctcaggcatcagca
tggctgcccacaacttcagcagaacgtgaacatcctctgtcatgcgtggtaactcctcaa
gatggggagactttagcacaaataatagaagaaaatttgaactgtcttggccatttaagc
actattatgcatgaagcaaatgagaaacagggcaacagtatgatgaatcttgattggagt
tggttaacagaatga

KEGG   Delphinapterus leucas (beluga whale): 111173552
Entry
111173552         CDS       T05885                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta isoform X1
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01523  Antifolate resistance
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04062  Chemokine signaling pathway
dle04064  NF-kappa B signaling pathway
dle04068  FoxO signaling pathway
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04380  Osteoclast differentiation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04625  C-type lectin receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04668  TNF signaling pathway
dle04722  Neurotrophin signaling pathway
dle04910  Insulin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04930  Type II diabetes mellitus
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle05010  Alzheimer disease
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05212  Pancreatic cancer
dle05215  Prostate cancer
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05222  Small cell lung cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111173552 (IKBKB)
   04014 Ras signaling pathway
    111173552 (IKBKB)
   04064 NF-kappa B signaling pathway
    111173552 (IKBKB)
   04668 TNF signaling pathway
    111173552 (IKBKB)
   04068 FoxO signaling pathway
    111173552 (IKBKB)
   04151 PI3K-Akt signaling pathway
    111173552 (IKBKB)
   04150 mTOR signaling pathway
    111173552 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111173552 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111173552 (IKBKB)
   04621 NOD-like receptor signaling pathway
    111173552 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    111173552 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    111173552 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    111173552 (IKBKB)
   04660 T cell receptor signaling pathway
    111173552 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    111173552 (IKBKB)
   04659 Th17 cell differentiation
    111173552 (IKBKB)
   04657 IL-17 signaling pathway
    111173552 (IKBKB)
   04662 B cell receptor signaling pathway
    111173552 (IKBKB)
   04062 Chemokine signaling pathway
    111173552 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111173552 (IKBKB)
   04920 Adipocytokine signaling pathway
    111173552 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111173552 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111173552 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111173552 (IKBKB)
   05206 MicroRNAs in cancer
    111173552 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111173552 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111173552 (IKBKB)
   05221 Acute myeloid leukemia
    111173552 (IKBKB)
   05220 Chronic myeloid leukemia
    111173552 (IKBKB)
   05215 Prostate cancer
    111173552 (IKBKB)
   05222 Small cell lung cancer
    111173552 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111173552 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111173552 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111173552 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    111173552 (IKBKB)
   04931 Insulin resistance
    111173552 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111173552 (IKBKB)
   05135 Yersinia infection
    111173552 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111173552 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    111173552 (IKBKB)
   05161 Hepatitis B
    111173552 (IKBKB)
   05160 Hepatitis C
    111173552 (IKBKB)
   05171 Coronavirus disease - COVID-19
    111173552 (IKBKB)
   05164 Influenza A
    111173552 (IKBKB)
   05162 Measles
    111173552 (IKBKB)
   05168 Herpes simplex virus 1 infection
    111173552 (IKBKB)
   05163 Human cytomegalovirus infection
    111173552 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111173552 (IKBKB)
   05169 Epstein-Barr virus infection
    111173552 (IKBKB)
   05165 Human papillomavirus infection
    111173552 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111173552 (IKBKB)
   05142 Chagas disease
    111173552 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    111173552 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111173552 (IKBKB)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     111173552 (IKBKB)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111173552 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr Pkinase_fungal IKKbetaNEMObind Kdo APH ubiquitin YrbL-PhoP_reg Com_YlbF TBK1_ULD
Other DBs
NCBI-GeneID: 111173552
NCBI-ProteinID: XP_022427021
UniProt: A0A2Y9N1I7
LinkDB
Position
Unknown
AA seq 882 aa
MYESLQDISMSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELS
PRNRERWCLEIQIMRSAEIQGGLAKGTLKRTELCTGRPELGLRCRQERCPGPGRVAEPPQ
RGGRQGRPRGHAEPGSQRPAPAGHGVLPGRGPAEARPRRGRGRREVFSGSFRLSGAVDQL
WLSSDGPASPRTAAQYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENI
VLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTL
AFECITGFRPFLPNWQPVQWHSKVRQKSEMDIVVSEDLNGAVKFSSSLPHPSNLNSVLAQ
RLEKWLQVMLMWQPRQRGTDPVYGPNGCFKALDDILNLKLVHVLNMVTGTIHTYPVAEDE
SLPSLQARIQQDTGIPEEDQELLQEAGLALTPDKPAAQCASDGKLNEGRTLDMDLVFLFD
NNRVAYETQISPRPQPESVSCILQEPKRSLPFFQLRKVWGQVWHSIQALKEDCGRLQQGQ
RAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSIQIDLEKYSEQKEFGITSDKLL
LAWREMEQAVELCGRENEVKQLVERMMALQTDIVDLQRSPLGWKQGGTLDDLEEQARELY
RRLREKPRDQRTDGDSQEMVRLLLQAIQGFEKKVRVIYTQLSKTVVCKQKALELLPKVEE
VVSLMSEDEKTVVRLQEKRQKELWNLLKIACSKVRGPVSGSPDSMNTSRLSHPSQLLSQP
CPAPDSLPEAVKKRCVPVRHAQCRSQGRVGHPSAVLEDLVAEAHTLCTQLENALQDTMKD
QDQSLRVMARGKPRRPTPFLSTANEKKQMERRCRASSIAVYT
NT seq 2649 nt   +upstreamnt  +downstreamnt
atgtacgagagtttgcaggacatcagtatgagctggtcaccttccctgccaacccagaca
tgcggggcctgggaaatgaaagaacggcttgggacagggggatttgggaacgtcatccga
tggcacaatcaggaaacgggcgagcagatcgctatcaagcagtgccggcaggaacttagt
ccccggaaccgcgagcgctggtgcctggagatccagatcatgaggagtgcggagatacag
ggaggactggccaagggcactctgaagagaacggagctctgcacggggcgcccagagctg
gggctacggtgccgacaggaacgctgcccgggccctgggcgagtggctgaaccaccccaa
cgtggtggccgccagggacgtccccgagggcatgcagagcctggctcccaacgacctgcc
cctgctggccatggagtactgccagggaggggacctgcggaagcaaggccgcgtcgggga
aggggtcggagggaggtgttcagtggctccttcaggctctcgggagcagtggaccaactg
tggctgagctcagatgggcctgcgtcccccaggaccgcggcacagtacctgaaccagttt
gagaactgctgtggcctgcgggaaggagccatcctcaccttgctgagcgacatcgcctct
gcacttagataccttcacgaaaacaggatcatccatcgggatctaaagccagaaaacatt
gtcctgcagcaaggggaacagagattaatacacaaaattattgacctaggatatgccaag
gagctggaccagggaagtctgtgcacttcctttgtggggaccctgcagtacctggcccct
gagctgctagagcagcagaagtacacggtgactgtggactactggagcttcggcaccttg
gccttcgagtgtatcacgggcttccggcccttcctgcccaactggcagcccgtgcagtgg
cactccaaagtccggcagaagagtgagatggacattgtggttagtgaggacctgaacgga
gccgtgaagttctccagctcgttaccccacccgagcaacctcaacagcgtcctggcccag
cggctggagaagtggctgcaggtgatgctgatgtggcagccccgacagaggggcaccgac
cccgtctacgggcccaatggctgcttcaaggccctggacgacatcttaaacttgaagctg
gttcacgtcttgaacatggtcacgggcaccattcacacctaccccgtggcagaggacgag
agtctgcctagcttgcaggcccggatccagcaggacacaggcatccctgaggaggaccag
gagctgctgcaggaagcgggtctggccttgacccccgacaagcccgccgctcagtgcgcc
tccgacggcaagctgaacgagggccgcaccctggacatggatctcgttttcctctttgac
aacaatagggtcgcctatgagacccagatctccccacggccccagcctgaaagcgtcagc
tgtatcctgcaagagcccaagaggagcctcccgttcttccagctgaggaaggtgtggggt
caggtctggcacagcatccaggccctgaaggaggactgcggccgcctgcagcagggccag
cgcgccgccatgatgaatctgctccggaacaacagctgcctgtccaagatgaagaattcc
atggcctctatgtctcagcagctcaaagccaagctggatttctttaaaaccagcatccag
attgacctggagaagtacagtgagcagaaagagtttgggatcacgtcagacaagctgctg
ctggcctggagggagatggagcaggccgtggagctctgtggacgggagaacgaggtgaag
cagctggtggagcggatgatggcgctacagacggacatcgtggacctgcagcgcagcccc
ctgggctggaagcagggcgggacgctggacgacctagaagagcaggcgcgggagctttac
cggaggctgagggagaagccccgagaccagcgaactgatggcgacagtcaggaaatggtg
cggctgctcctgcaggcaatccaaggttttgagaagaaagtgcgagtgatctatacgcag
ctcagtaagactgtggtctgcaagcagaaggctctggagctgctgcccaaggtggaggag
gtggtgagcttaatgagcgaggacgagaagactgtggttcggctgcaggagaagcggcag
aaggagctctggaacctcctgaagattgcttgtagcaaggtccgcggtcccgtcagcgga
agcccagacagcatgaacacgtcccgcctgagtcaccccagccagctgctgtcgcagcct
tgcccagcccctgacagcttacccgaggccgtcaagaagaggtgcgtccccgttcgccat
gcccagtgcaggagtcagggacgtgtcggtcacccgtcggcggttctcgaagacctcgtg
gctgaagcacacactctgtgtacgcagctggaaaacgccctacaggacaccatgaaggac
caggaccagagcttaagggtaatggcccgtgggaagccccgccgccccacgccctttctt
tctacagcaaacgagaaaaagcagatggaaaggcgatgccgtgcttcctcgatcgcagtg
tacacttag

DBGET integrated database retrieval system