KEGG   Delphinapterus leucas (beluga whale): 111171663
Entry
111171663         CDS       T05885                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta isoform X1
  KO
K11220  signal transducer and activator of transcription 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04062  Chemokine signaling pathway
dle04217  Necroptosis
dle04380  Osteoclast differentiation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04917  Prolactin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle05140  Leishmaniasis
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05212  Pancreatic cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111171663 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111171663 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111171663 (STAT1)
   04621 NOD-like receptor signaling pathway
    111171663 (STAT1)
   04625 C-type lectin receptor signaling pathway
    111171663 (STAT1)
   04658 Th1 and Th2 cell differentiation
    111171663 (STAT1)
   04659 Th17 cell differentiation
    111171663 (STAT1)
   04062 Chemokine signaling pathway
    111171663 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111171663 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    111171663 (STAT1)
   04919 Thyroid hormone signaling pathway
    111171663 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111171663 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111171663 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111171663 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111171663 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    111171663 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111171663 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111171663 (STAT1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111171663 (STAT1)
   05160 Hepatitis C
    111171663 (STAT1)
   05171 Coronavirus disease - COVID-19
    111171663 (STAT1)
   05164 Influenza A
    111171663 (STAT1)
   05162 Measles
    111171663 (STAT1)
   05168 Herpes simplex virus 1 infection
    111171663 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111171663 (STAT1)
   05169 Epstein-Barr virus infection
    111171663 (STAT1)
   05165 Human papillomavirus infection
    111171663 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111171663 (STAT1)
   05140 Leishmaniasis
    111171663 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111171663 (STAT1)
Transcription factors [BR:dle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    111171663 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra BLI1
Other DBs
NCBI-GeneID: 111171663
NCBI-ProteinID: XP_022422976
UniProt: A0A2Y9MPV2
LinkDB
Position
Unknown
AA seq 749 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIICNCLKEERKILENAQ
RFNQAQAGNIQSTVMLDKQQELDSRVRNVKDKVMCIEHEIKTLEDLQDEYDFKCKTLQNR
EHETNGVAKNDQKQEQMLLQKMYLMLDNKRKEVVHKIIELLNATELTQKALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQA
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGARTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETASLPIVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPSAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLCLWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERPQNGGESCFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSQLQTT
DNLLPMSPEEFDEVSRIVGAVEFDMMNAV
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgtcccagtggtatgagcttcagcagcttgactccaaattcctggagcaggttcaccag
ctctatgatgacagttttcccatggaaatcagacagtatctggcacagtggctagaaaag
caagactgggagcatgccgccaatgatgtttcatttgctaccatccgttttcacgacctc
ctgtcgcagctggatgatcaatacagtcgcttttctttggagaataattttttgttgcag
cataacataaggaaaagcaagcgtaatcttcaggataattttcaggaagacccaatacag
atgtctatgatcatctgtaactgtctgaaggaggaaagaaagatcttggaaaatgcccag
agattcaatcaggctcaggcagggaatattcagagcactgtaatgttagacaaacagcag
gagcttgacagcagagtcagaaatgtgaaggacaaagttatgtgtatagagcatgaaatc
aagaccctagaagatttacaggatgaatatgactttaaatgtaaaaccttgcagaacaga
gaacatgaaaccaatggtgtggcaaagaatgatcagaaacaggaacagatgttactccag
aagatgtatttaatgcttgacaataagagaaaggaagtagttcacaaaataatagagttg
ttgaatgccactgaacttacccagaaggccctgattaatgatgaacttgtggaatggaag
cggagacagcagagtgcctgtatcgggggaccccccaatgcttgtcttgatcagctgcag
aactggttcaccatagtggcggagagtctgcagcaggttcgtcagcagcttaaaaagctt
gaggagttggaacagaaatatacctatgaacatgaccctatcacaaaaaacaaacaagcg
ttatgggaccgcaccttcagcctcttccagcagctcattcagagctcatttgtggtggaa
agacagccctgcatgccaactcatcctcagaggccattggtcctgaagactggagtacaa
ttcactgtgaagttgagattgttggtgaaattgcaagagctgaattataacttgaaagtc
aaagtcttatttgataaagatgtgaatgagagaaatacagtaaaagggtttcgaaagttc
aacattttgggcactcacacgaaggtgatgaacatggaggagtccaccaatggaagtctg
gcggcagaattccgacacctgcaactgaaagaacagaaaaacgctggtgccagaaccaac
gagggtcctctcatcgttactgaagagcttcactcccttagttttgaaacccagttgtgc
cagcctggtttggtcattgaccttgagacggcctctctgcccatcgtggtgatctccaat
gtcagccagctcccgagtggttgggcctccatcctgtggtacaacatgctggtggcagaa
cccaggaatctgtccttcttcctgaacccgccttgtgcacgatggtctcagctttcagag
gtgctgagttggcagttttcttctgtcaccaaaagaggtctcaatgtggaccagctgaac
atgctgggagagaaacttcttggtcccagtgctggccctgatgggcttattccatggact
cgcttctgtaaggaaaatataaatgataaaaattttcctttctggctttggatcgaaagc
atccttgaactcattaaaaaacacctgctctgtctctggaatgatgggtgtatcgtgggc
tttatcagcaaggagcgagagcgggctctgctgaaggaccagcagccggggacattcctg
ctgcggttcagtgagagctgccgggaaggggccatcacgttcacatgggtggagcggccc
cagaatggaggtgaatcttgcttccatgcggttgaaccctacacaaagaaagaactttct
gctgttactttccctgacattattcgcaattacaaagtcatggccgctgaaaatattcca
gagaatcccttgaagtatctgtatccaaatatcgataaagaccatgcctttggaaagtac
tactccaggccaaaggaagccccagagcctatggaacttgatggccctaaaggaacagga
tatatcaagactgaattgatttctgtgtctgaagttcacccttctcaacttcagaccaca
gacaaccttcttcccatgtctcctgaggagtttgacgaggtgtctcggatagtgggcgct
gtagaatttgacatgatgaatgcagtataa

DBGET integrated database retrieval system