KEGG   Delphinapterus leucas (beluga whale): 111171885
Entry
111171885         CDS       T05885                                 

Gene name
IRS1
Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  insulin receptor substrate 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04022  cGMP-PKG signaling pathway
dle04068  FoxO signaling pathway
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04722  Neurotrophin signaling pathway
dle04910  Insulin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04923  Regulation of lipolysis in adipocytes
dle04930  Type II diabetes mellitus
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle04935  Growth hormone synthesis, secretion and action
dle04960  Aldosterone-regulated sodium reabsorption
dle05010  Alzheimer disease
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111171885 (IRS1)
   04022 cGMP-PKG signaling pathway
    111171885 (IRS1)
   04151 PI3K-Akt signaling pathway
    111171885 (IRS1)
   04152 AMPK signaling pathway
    111171885 (IRS1)
   04150 mTOR signaling pathway
    111171885 (IRS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111171885 (IRS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111171885 (IRS1)
   04923 Regulation of lipolysis in adipocytes
    111171885 (IRS1)
   04920 Adipocytokine signaling pathway
    111171885 (IRS1)
   04935 Growth hormone synthesis, secretion and action
    111171885 (IRS1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111171885 (IRS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111171885 (IRS1)
  09149 Aging
   04211 Longevity regulating pathway
    111171885 (IRS1)
   04213 Longevity regulating pathway - multiple species
    111171885 (IRS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111171885 (IRS1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111171885 (IRS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111171885 (IRS1)
   04932 Non-alcoholic fatty liver disease
    111171885 (IRS1)
   04931 Insulin resistance
    111171885 (IRS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dle04990]
    111171885 (IRS1)
Domain-containing proteins not elsewhere classified [BR:dle04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   111171885 (IRS1)
SSDB
Motif
Pfam: IRS PH PH_11
Other DBs
NCBI-GeneID: 111171885
NCBI-ProteinID: XP_022423539
UniProt: A0A2Y9MMM9
LinkDB
Position
Unknown
AA seq 1248 aa
MASPPETDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGH
HDGAAAPGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFKEVWQVILKPKGLGQTKNLI
GIYRLCLTSRTISFVKLNAEAAAVVLQLMNVRRCGHSENFFFIEVGRSAVTGPGEFWMQV
DDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHLNNPPPSQVGLT
RRSRTESITATSPASLVGGKQGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHR
GSSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSP
SDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGASTLTAPN
GHYILPRSGNGPRYIPAAGLGTSPALTGDEAASAADLDNRFRKRTHSAGTSPTISHQKTP
SQSSVASIEEYTEMMPAYPPGGGSGGRVPSYRHSAFVPTHSYPEEGLEMHPLERRVGHHR
PDTSNLHTDDGYMPMSPGVAPVPGSRKGSGDYMPMSPKSVSAPQQIINPIRRHPQRVDPN
GYMMMSPSGSCSPDIGGGPSSGGSSGAAPSGSSYGKLWTNGVGGHHSHALPHPKLPVESS
SGKLLSCTGDYMNMSPVGDSNTSSPSDCYYGPEDPQHKPVLSYYSLPRSFKHTQRPGELE
EGARHQHLRLSSSSGRLLYAAAAEDSSSSTSSDSLGGGYCAARPEPGLPHLHHQVLQPHL
PRKVDTAAQTNSRLARPTRLSLGDPKASTLPRAREQPQPQPQPPPPLLPPPEPKSPGEYV
NIEFGSDQPGYLSGPGASHSSPSVRCPSQLQPAPREEETGAEEYMNMDLGPGRRAAWRES
AGVQPGSMGPAPPGDASVCRPTRAVPSSRGDYMTMQMGCPRQSYVDTSPVAPISYADMRT
GGGGLVEEASLPGAAAATPSSSSKASASPAAPQGAEELAARSSLLGGPQGPGGSSAFTRV
NLSPNCNQSAKVIRADPQGCRRRHSSETFSSTPSATRAGNTVPFGGAAAAGGGGGGGSSS
TEDVKRHSSASFENVWLRPGELGGAPKELAQVCGAAGGLENGLNYIDLDLVKDFNQSPQE
RPAQPQPSPPPPPHQPLGRSESGSSSRSSEDLSAYASISFQKPPEDLQ
NT seq 3747 nt   +upstreamnt  +downstreamnt
atggcgagccctcccgagaccgacggcttctccgacgtgcgcaaggtgggctacctgcgc
aagcccaagagcatgcacaagcgattcttcgtgctgcgggcggccagcgaggctgggggc
ccggcgcgcctcgagtactacgagaacgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcgatccccctcgagagctgcttcaacatcaacaagcgggccgactccaagaac
aagcacctggtggccctctatacccgggacgagcactttgccatcgcggcggacagcgag
gccgagcaggacagctggtaccaggccctcctgcagctgcacaaccgtgccaagggccac
cacgacggggccgcggcccccggggcgggaggcggcgggggcagctgcagtggcagctcc
ggccttggcgaggctggggaggacttgagctacggggacgtgcccccaggacccgccttc
aaggaagtctggcaggtgatcctgaaacccaagggcctgggtcagaccaagaacctgatt
ggcatctaccgcctctgcctgaccagcaggaccatcagcttcgtgaagctgaacgcggag
gccgccgcagtggtgctgcagctgatgaacgtcaggcgctgcggccactcagagaacttc
ttcttcatcgaagtgggccgttccgccgtgacgggacccggggagttctggatgcaggtg
gatgactctgtggtggcccagaacatgcacgagacgatcctggaagccatgcgggccatg
agcgatgagttccgccctcgaagcaagagccagtcctcctccaactgctccaaccccatc
agtgtccccctgcgcaggcatcacctcaacaaccctccacccagccaggtggggctgacc
cgccgctcgcgcacagagagcatcactgccacctccccggccagcttggtgggcgggaag
cagggctccttccgggtccgcgcctctagtgatggcgaaggcaccatgtctcgccctgcc
tctgtggacggcagtcctgtgagtcccagcaccaacaggacccatgcccaccggcatcgc
ggcagttcccggctgcacccgcctctcaaccacagccgctccatccccatgccttcttct
cgctgctcgccttccgccaccagcccggtcagtctatcgtccagtagcaccagtggccac
ggctccacctcggactgtctcttcccgcggcggtctagtgcttccgtgtccggttccccc
agtgatggcggtttcatctcctctgatgagtatggctccagtccctgcgacttccgaagt
tccttccgcagtgtcaccccggattccctgggccacaccccgccggcccgcggtgaggag
gagctgagcaactacatctgcatgggaggcaagggggcctccaccctcacggcccccaat
ggtcactacattttgcctcggagtggcaacggtccccgctacatcccggcagccggcttg
ggcacgagcccagccctgacaggggatgaagcagccagtgctgcagatctggacaatcgg
ttccgaaagcggactcactctgctggcacgtcacctaccatttcccaccagaagacccca
tcccagtcctctgtggcctccattgaggaatataccgagatgatgcctgcctacccacca
ggaggtggcagtggaggccgagtgcccagctaccggcactccgccttcgtgcccacccac
tcctacccagaggagggtctggaaatgcaccccttggagcggcgtgtgggccaccaccgc
ccagacacctccaacctccacaccgatgatggctacatgcccatgtccccaggggtggcc
ccagtgcccgggagccgaaagggcagtggggactacatgcccatgagccccaagagcgtg
tctgcccctcagcagatcatcaaccccatcagacgccatccccagagagtggaccccaat
ggctacatgatgatgtccccaagcggcagctgctctcctgacattggaggcgggcccagc
agcggcggcagcagcggtgccgccccttctgggagcagctatggcaagctctggacgaat
ggggtagggggccaccactctcacgcgctgccacaccccaaactccctgtggagagcagt
agcggcaagctgttgtcttgtacgggtgactacatgaacatgtcgccagtgggggactcc
aacaccagcagcccttccgactgctactatggccctgaggacccccagcacaagccagtc
ctctcctactactcattgccaaggtcctttaagcacacccagcgccccggggagctggag
gagggcgcccggcaccagcacctccgcctttcctccagctcgggtcgactcctctatgct
gcggcggcggaagattcctcctcgtccaccagcagcgacagcctgggcgggggatactgc
gcggctaggcccgagcccggcctcccgcatctccaccatcaggtcctgcagccccatctg
cctcgaaaggtggacacagctgcccagaccaacagccgcctggcccggcccacgaggctg
tccctgggggatcccaaggccagcaccttaccccgggcccgagagcagccgcagccccag
ccgcagccgccgccgcccctgctgccccctccggaacccaagagcccaggggaatatgtg
aatattgaatttgggagcgatcagccgggctacttatcaggcccgggggcttcccacagc
tcgccttctgtccggtgtccatcccagctccagccggctcccagagaggaggagacgggc
gcggaagagtacatgaacatggacctggggccgggccggagggccgcctggcgggagagc
gctggggtccagccgggcagcatgggcccggcaccccctggagatgctagcgtgtgcagg
cccaccagggcagtgcccagcagccggggtgactacatgaccatgcagatgggctgtccc
cggcagagctacgtggacacctcgccagtcgcccccatcagctatgcggacatgcggacc
ggcggcggcggcctcgtggaggaggccagcctgcctggggccgccgcggccacgccctcc
tcatcctcgaaggcctctgcttcccccgccgcgcctcaaggagcagaggagctggcggcc
cgctcttccctgctggggggcccgcagggacccgggggctcgagtgccttcacgcgggtg
aacctcagtcccaactgcaaccagagtgccaaagtgatccgtgccgacccgcaagggtgc
aggaggcggcacagctccgagaccttctcctcgacgcccagtgccaccagggcaggcaac
acggtgcccttcggaggggcggctgcagccgggggcggcggtggtggcggcagcagcagc
acggaggacgtgaaacgccacagctctgcttcctttgagaacgtgtggctgcggcctggg
gagctcgggggagcccccaaggagctggcccaagtgtgcggggccgccgggggtttggag
aatgggcttaactacatagacctggatttggtcaaggacttcaaccagagccctcaagag
cgtcccgctcagccgcagccttctcctcccccaccccctcatcagcctctgggacgcagc
gagagcggctccagcagccgctccagcgaggatttaagcgcctatgccagcatcagtttc
cagaagccgccagaggacctccagtag

DBGET integrated database retrieval system