KEGG   Delphinapterus leucas (beluga whale): 111172045
Entry
111172045         CDS       T05885                                 

Gene name
TFRC
Definition
(RefSeq) transferrin receptor protein 1 isoform X1
  KO
K06503  transferrin receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04066  HIF-1 signaling pathway
dle04144  Endocytosis
dle04145  Phagosome
dle04216  Ferroptosis
dle04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    111172045 (TFRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111172045 (TFRC)
   04145 Phagosome
    111172045 (TFRC)
  09143 Cell growth and death
   04216 Ferroptosis
    111172045 (TFRC)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111172045 (TFRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dle01002]
    111172045 (TFRC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111172045 (TFRC)
   04090 CD molecules [BR:dle04090]
    111172045 (TFRC)
Peptidases and inhibitors [BR:dle01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   111172045 (TFRC)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111172045 (TFRC)
  Exosomal proteins of colorectal cancer cells
   111172045 (TFRC)
CD molecules [BR:dle04090]
 Proteins
  111172045 (TFRC)
SSDB
Motif
Pfam: Peptidase_M28 TFR_dimer PA
Other DBs
NCBI-GeneID: 111172045
NCBI-ProteinID: XP_022423971
UniProt: A0A2Y9MY54
LinkDB
Position
Unknown
AA seq 772 aa
MLSLCPFFFFKSQFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENVDNNMRGNHTNV
TKPKRLNGYICYGTIAVIVFFLIGFMIGYLGYCKRVEPKADCERPAGREPSCTEETEPFE
TEEQLPETRRIFWADLKSMLSKRLDAIDFTSAIKMLNGNSYIPREAGSQKDESLAFYIEN
QFRELKLSKAWHDEHFVKIQVKGSSAHNSVTIVSESGSSSTAYQVENPEGYVAYSKATTV
TGKLVHANFGTKKDFEDLNMPVNGSLVIVRAGKITFAEKAANAESLNAIGVLIYMDQTKF
PIVNADLPVFGHAHLGTGDPYTPGFPSFNHTQFPPSQSSGLPNIPVQTISRAGAEKLFQN
MEGDCPSIWGLDSSCKLVSSQNNNVKLTVNNVLKEIRIFNIFGVIKGFEEPDRYVIVGAQ
RDAWGPGAAKSSVGTSLLLKLAQILSDMVLKGQFKPSRSIVFASWSGGDFGAIGATEWLE
GYLASLHLKAFTYINLDKAVLGTSKFKVSSSPLLYSLIEKTMQDVKHPVTGLSLYRDSNW
INKVEKLSFDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTPMDTYEVLNQNVPQLNKMAR
AAAEVAGLLVIKLTHDVELNLNYEMYNDKILWFVREMNQFRADIKEMGLNLQWLYSARGD
FFRATSRLTTDYKNAERTNRFVMREINDRIMKVEYHFLSPYVSPRESPFRHIFWGSGSHT
LSALLEHLKLRRKNNGAFNETLLKNQLALATWTIQGAANALSGDIWDIDNEF
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgctttctctctgtccttttttcttttttaaatctcagtttggtggagaaccattgtca
tatacccggtttagtctggctcggcaagtagatggcgataacagtcatgtggagatgaaa
ctagctgtagatgaagaagaaaatgttgacaataacatgaggggtaaccacaccaatgtc
acaaaaccaaaaaggttaaatggatatatctgctatgggactattgctgtaatcgtcttt
ttcttgattggatttatgattggctacttgggctattgtaaacgtgtagaaccaaaagcc
gattgtgagagaccggcaggaagagagccttcgtgcacagaggagacagaacctttcgaa
acagaagagcagctccccgaaacacgtcgcatattttgggcagacctcaaatcaatgttg
tccaagagactggatgccatagacttcaccagtgccatcaagatgctgaatggaaattct
tacatccctcgtgaggctggatctcaaaaagatgaaagccttgctttttacattgaaaat
cagttccgtgaacttaaactcagcaaagcctggcatgatgaacattttgttaagattcag
gtcaaaggcagcagtgctcacaactcggtgaccatagtgagtgagagcggcagcagcagt
acggcctaccaggtggagaatcccgagggttatgtggcgtatagtaaggctacgacagtt
actggtaaactggtccatgctaattttggcactaaaaaagactttgaggatttaaatatg
cctgtgaatggatctttagtgattgttagagcagggaaaattacttttgctgaaaaggct
gcaaatgctgaaagtttaaatgcaatcggtgtcttgatatacatggaccagactaaattt
cccattgttaatgcagatcttccagtttttggacatgctcatctgggaacaggtgaccct
tacacacctggattcccttctttcaatcacactcagtttccaccatctcagtcatcagga
ttgcctaacatacctgtccaaacaatttccagagctggtgcagaaaagctatttcaaaat
atggaaggagactgtccttctatttggggattagactcttcatgtaagctggtatcctca
cagaacaacaatgtgaagctcactgtgaacaatgtgctgaaagagataagaatttttaac
atctttggagttattaagggctttgaagaaccagatcgctatgttatagtaggggcccag
agggatgcctggggtcctggagctgcaaagtccagtgtaggaacaagtctcctattgaaa
cttgcccagatactttccgatatggtcttaaaaggtcagtttaaacccagcaggagcatt
gtctttgccagctggagtggtggagactttggagctattggtgccactgaatggctagag
ggataccttgcctccttgcatttaaaggctttcacttacattaacctggataaagctgtt
cttggtaccagcaaattcaaagtttcttccagcccactgttgtattcgcttattgagaag
acgatgcaagatgtgaaacatccagttactgggctttctctatatcgggacagcaactgg
atcaacaaagtcgagaaactttcttttgataatgctgctttccctttccttgcatattct
ggaatcccagcagtctctttctgtttttgtgaggacacagattacccttatttgggtact
cccatggatacctatgaggtactgaatcagaatgttcctcagttgaacaaaatggcacgt
gcagcagcagaagtagccggtctgcttgtgattaaacttacccatgatgttgaattgaac
ctgaactatgagatgtataatgacaaaatactttggtttgtgagagaaatgaaccagttc
agagcagacataaaggagatgggtctgaatctacagtggttgtattctgctcgtggagac
ttcttccgtgctacgtctagactaacaacagattataagaatgctgagaggacaaacaga
tttgtcatgagggagatcaatgaccgtatcatgaaagtggaatatcacttcctgtcaccc
tacgtatctccaagggagtctcctttccgacatatcttctggggctctggctctcacact
ctgtcagctttactagagcacttaaagctgcggcggaaaaataacggtgcttttaatgaa
acactgttgaaaaaccagttggctctagcaacttggactattcagggagctgcaaatgcc
ctctctggtgacatctgggacattgacaatgaattttaa

DBGET integrated database retrieval system