KEGG   Delphinapterus leucas (beluga whale): 111172328Help
Entry
111172328         CDS       T05885                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega-1 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00480  Glutathione metabolism
dle00980  Metabolism of xenobiotics by cytochrome P450
dle00982  Drug metabolism - cytochrome P450
dle00983  Drug metabolism - other enzymes
dle01100  Metabolic pathways
dle01524  Platinum drug resistance
dle05200  Pathways in cancer
dle05204  Chemical carcinogenesis
dle05225  Hepatocellular carcinoma
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111172328 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    111172328 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    111172328 (GSTO1)
   00983 Drug metabolism - other enzymes
    111172328 (GSTO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111172328 (GSTO1)
   05204 Chemical carcinogenesis
    111172328 (GSTO1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111172328 (GSTO1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111172328 (GSTO1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111172328 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dle02000]
    111172328 (GSTO1)
Enzymes [BR:dle01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     111172328 (GSTO1)
Transporters [BR:dle02000]
 Other Transporters
  Pores ion channels [TC:1]
   111172328 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 Glutaredoxin Corona_S2
Motif
Other DBs
NCBI-GeneID: 111172328
NCBI-ProteinID: XP_022424535
UniProt: A0A2Y9MRD8
LinkDB All DBs
Position
Unknown
AA seq 267 aa AA seqDB search
MGAPLGHQAELWCDRHLRCLKLCPSKPGRPALGRGLRGSAPPGQVPEGLIRVYSMRFCPF
AKRTLLVLKAKGIGHEVININLKNKPEWFFKKNPFGLVPVLENSQGQVIYESAITCEYLD
EAYPGKKLLPDDPYEKACQKMVFELFSKVPPLLLSFLRRQNKEDCSGLKEELHKEFSKLE
EVLTNKKTTFFGGSSLSMIDYLIWPWFEWLVALELNEYVNHTPNLKLWMEAMMKDPAVSS
LFIDPKAFRGFLDLYLQNNLEACDYGL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgggggcacctcttggccatcaggctgaactttggtgcgaccgccatctgcggtgtttg
aagctttgccccagcaaaccgggaaggccggccctgggtcggggcttacggggaagcgcg
cccccggggcaggtccccgagggcctgattcgcgtctacagtatgaggttctgcccgttc
gccaagaggacgctcctggtcctgaaggccaagggaattgggcatgaagtcattaacatc
aacctaaaaaataagcctgagtggttcttcaagaagaatcccttcggcctggtgccagtt
ctggaaaacagtcagggtcaagtgatctacgaatctgccatcacttgtgagtacctggat
gaagcatatccaggaaagaagctgttgccagatgacccctatgagaaagcttgccaaaag
atggtctttgagttgttttctaaggtaccacctttgttattaagctttcttagaaggcaa
aataaggaagactgctctggcctgaaagaagaattgcataaagaattcagcaagctagag
gaggttctgactaataagaagacaaccttctttggtggcagttctctttctatgattgat
tacctcatctggccctggtttgaatggctggtagccctggagttaaatgagtatgtaaac
cacactccaaatcttaagctctggatggaagccatgatgaaagatcctgcagtatcatcc
ctcttcattgatccaaaagcctttcgaggtttcttagatctctacttgcagaacaacctc
gaggcctgtgactatgggctctga

DBGET integrated database retrieval system