KEGG   Delphinapterus leucas (beluga whale): 111172519
Entry
111172519         CDS       T05885                                 

Gene name
FAS
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6 isoform X1
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle04010  MAPK signaling pathway
dle04060  Cytokine-cytokine receptor interaction
dle04115  p53 signaling pathway
dle04210  Apoptosis
dle04217  Necroptosis
dle04650  Natural killer cell mediated cytotoxicity
dle04668  TNF signaling pathway
dle04932  Non-alcoholic fatty liver disease
dle04940  Type I diabetes mellitus
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05142  Chagas disease
dle05143  African trypanosomiasis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05320  Autoimmune thyroid disease
dle05330  Allograft rejection
dle05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111172519 (FAS)
   04668 TNF signaling pathway
    111172519 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111172519 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111172519 (FAS)
   04217 Necroptosis
    111172519 (FAS)
   04115 p53 signaling pathway
    111172519 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111172519 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111172519 (FAS)
   05205 Proteoglycans in cancer
    111172519 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111172519 (FAS)
   05330 Allograft rejection
    111172519 (FAS)
   05332 Graft-versus-host disease
    111172519 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111172519 (FAS)
   05022 Pathways of neurodegeneration - multiple diseases
    111172519 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111172519 (FAS)
   04932 Non-alcoholic fatty liver disease
    111172519 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111172519 (FAS)
   05161 Hepatitis B
    111172519 (FAS)
   05160 Hepatitis C
    111172519 (FAS)
   05164 Influenza A
    111172519 (FAS)
   05162 Measles
    111172519 (FAS)
   05168 Herpes simplex virus 1 infection
    111172519 (FAS)
   05163 Human cytomegalovirus infection
    111172519 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111172519 (FAS)
   05169 Epstein-Barr virus infection
    111172519 (FAS)
   05165 Human papillomavirus infection
    111172519 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111172519 (FAS)
   05143 African trypanosomiasis
    111172519 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111172519 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111172519 (FAS)
   04090 CD molecules [BR:dle04090]
    111172519 (FAS)
Cytokine receptors [BR:dle04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   111172519 (FAS)
CD molecules [BR:dle04090]
 Proteins
  111172519 (FAS)
SSDB
Motif
Pfam: Death TNFR_c6
Other DBs
NCBI-GeneID: 111172519
NCBI-ProteinID: XP_022425110
UniProt: A0A2Y9MT08
LinkDB
Position
Unknown
AA seq 334 aa
MSEIWVLWPLIFTSIAGPLSKGDNAHVADSNSEMLKLSKNITKRESCDEGLYREHEFCCQ
PCPPGKRKNDDCKIEGGEPECVLCAEGEEYTDKNHHSYKCRRCRVCDGEHGLEVEKNCTR
TQNTKCRCKPNFFCNVSLCEHCNPCTTCEHGIIEKCTPTSNTKCREVFQSTGSRSNLHSL
WAPLILILISAVIYREVKRRRRNRKNGHQKSIASNTEMMPVNFTDIDLGKHIISIAEQMK
ITEVKEFVRKNGMEETKIDEIKHDNPQDTAEQKVQLLRNWYQSHGKKDAYCTLIKSLRKA
KLHALAEKIQDIVQKDITSEHENADLQNENESLA
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtccgagatctgggttctctggccactgatatttacctccattgctggaccattatct
aaaggtgataatgcccatgtggctgatagcaactctgagatgctgaaattgagtaagaat
attactaaaagggagagctgcgatgaaggcctgtatcgtgagcacgaattttgttgtcag
ccgtgtcctcctggcaaacggaaaaatgatgattgcaaaattgaaggaggtgaaccagaa
tgtgtactctgtgcagagggggaggagtacacagacaagaaccatcattcttataagtgc
agaagatgtagagtttgtgatggagaacatggcctagaagtggaaaaaaactgtacccgg
acccagaataccaagtgcagatgtaaaccaaactttttttgtaacgtatctctgtgcgaa
cactgtaacccttgtaccacgtgtgaacatggaatcattgagaaatgcacaccaaccagc
aacaccaaatgcagagaagtgttccaatctacaggatccagatctaacttacacagttta
tgggcccccctgatcctcattctaatatctgcagtaatatacagggaggtgaaaagacgg
cgcaggaatagaaagaatggtcaccagaaatctatagcctcaaatactgaaatgatgcca
gtgaatttcacagacattgacttgggaaaacatatcattagtattgctgaacaaatgaaa
ataactgaagttaaagaatttgttcggaagaatggtatggaggaaactaaaatagatgag
atcaagcacgacaatccccaagatacagctgaacagaaagtccaactgctccgtaattgg
tatcaaagtcatgggaagaaagatgcatattgcactttgattaaaagtctcagaaaagcc
aaacttcatgctcttgcagagaaaattcaagatatagtccagaaggacattactagtgaa
catgaaaatgcagacttgcaaaatgaaaatgaaagcttggcttaa

DBGET integrated database retrieval system