KEGG   Delphinapterus leucas (beluga whale): 111172761
Entry
111172761         CDS       T05885                                 

Gene name
STAM2
Definition
(RefSeq) signal transducing adapter molecule 2 isoform X1
  KO
K04705  signal transducing adaptor molecule
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04144  Endocytosis
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111172761 (STAM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111172761 (STAM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111172761 (STAM2)
Membrane trafficking [BR:dle04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    111172761 (STAM2)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM PG_binding_4 GAT
Other DBs
NCBI-GeneID: 111172761
NCBI-ProteinID: XP_022425430
UniProt: A0A2Y9MU11
LinkDB
Position
Unknown
AA seq 526 aa
MPLFTANHFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPH
VALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEF
QKDPQFSLISATIKSMKEEGITFPSAGSQTVSVAAKDGTSLNKNKEDEDIAKAIELSLQE
QKQQHTETKSLYPSAEIPSNNKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWW
KGENHRGIGLFPSNFVTTNLNIEPEAAAVDKLNVIDDEEEEIKKSEPEPVYIDEDKMDRA
LQVLQSIDPTDSKPDSQDLLDLEDICQRMGPMIDEKLEEIDRKHSELSELNVKVLEALEL
YNKLMNEAPVYSVYSKIHHPAHYPPSSAGVPMQTYPVQPHGANYMGQSIHQVTVAQSYSL
GPDQIGPVRSLPPNVNSSVTTQPAPTPYLSAGQDTVSNPTYMNQNSHLQSATGAAAYTQQ
MGMSVDLSSHQSTTSSLPRSAGFAVAAPAHSVAQQQTDYPQQQPLL
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgcctctgttcaccgccaaccacttcgagcaagatgtggaaaaggccacaaatgagtac
aacactacagaagattggagtcttattatggacatatgtgacaaagttggaagcactcct
aatggagcaaaagattgcctaaaagccataatgaaaagggtaaatcataaggttcctcat
gttgctctgcaggcgttaactcttcttggggcttgtgtggcaaactgtggaaagatattt
catttagaagtatgttcccgtgattttgcaacagaagtacgtgctgtgataaaaaataag
gctcatcctaaagtatgtgaaaaactgaaatctttaatggtggagtggtcagaagaattt
cagaaggaccctcagtttagtctgatatctgcaactattaaatctatgaaagaagaagga
attacttttccttcagcaggttctcagactgtctcagttgctgccaaggacggtacgtca
ttgaacaaaaacaaagaagatgaagatatagctaaagctattgaattatcattgcaagag
cagaagcagcagcacacagagacaaaatctttatatccatctgcagaaattccatcaaat
aataaagttgcaaggaaagtgagagctttatatgattttgaagctgtggaggacaatgaa
ctcacctttaaacatggtgaaattattattgttttggatgacagtgatgccaattggtgg
aaaggagaaaatcacagaggaataggactcttcccatctaattttgtaaccactaattta
aacatagaacctgaggcagcagctgtggacaaattgaatgtaattgatgatgaagaggag
gaaattaagaaatcagagcctgagcctgtttacatagatgaggataagatggatagagcc
ctgcaagtactgcagagtatagatccaacagattcaaaaccagactcccaagacctcttg
gacttagaagatatctgccaacggatgggtccaatgatagatgaaaaacttgaagagatc
gataggaagcattcagaattgtctgagttgaatgtaaaagtcttggaagctctggaacta
tataacaagttgatgaatgaagcaccagtatattcagtctattcaaagatccatcatcca
gcacattacccaccttcatcagctggagttccaatgcagacatatccagttcaaccacat
ggtgcaaactatatgggtcaaagtattcaccaagtcactgttgcccaaagctacagccta
ggaccagatcaaatcggtccagtgagatcgctgcctccaaatgtgaattcctcagtgaca
acacagcctgctccaactccatatttaagtgctggacaagacactgtttccaatcctact
tacatgaatcagaactctcaccttcaatcagctactggtgcagctgcttacacgcagcaa
atggggatgtctgtggatctgtcatctcaccagagcactacttccagtttgccgcggtcg
gcagggtttgcagtggcagctccagctcattcagttgcacagcagcaaacagattaccct
cagcagcagcctctcctttaa

KEGG   Delphinapterus leucas (beluga whale): 111178113
Entry
111178113         CDS       T05885                                 

Gene name
STAM
Definition
(RefSeq) signal transducing adapter molecule 1
  KO
K04705  signal transducing adaptor molecule
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04144  Endocytosis
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111178113 (STAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111178113 (STAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111178113 (STAM)
Membrane trafficking [BR:dle04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    111178113 (STAM)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT SH3_10
Other DBs
NCBI-GeneID: 111178113
NCBI-ProteinID: XP_022436320
UniProt: A0A2Y9NQR4
LinkDB
Position
Unknown
AA seq 526 aa
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAI
ELSLKEQRQQSTTLSSLYPSTSNLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGMGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEQA
YIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQQYYIQSSGVSGSQVYPGPPQSGAYLVAGSA
QLSQPQSYSLPPEQLSSLSQGAVLSASPALPSQQAQASYPNTMGTSVQGGTYPSQASVYS
PPPAAPDVTIYQNAGSSLSQVPNYTLTSALPQPPPPQQPYSPKALL
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgcctctctttgccaccaatcccttcgatcaggacgtcgagaaagcaaccagtgagatg
aatactgctgaggattggggcctcattttggatatttgtgataaagtcggtcagtctcgc
actggacctaaagattgtcttcggtctattatgaggagggtgaaccataaagatcctcat
gttgctatgcaggctctgactcttctaggagcgtgtgtatcgaattgtggcaaaattttt
cacttagaagtatgttcaagagattttgctagtgaagtaagcaacgtattaaacaagggt
catcctaaagtgtgtgaaaaattaaaggctcttatggttgaatggacggatgagtttaag
aatgatccacaacttagtctaatatcagcaatgattaagaaccttaaggaacaaggtgtt
acgtttccagctattggctctcaggctgcagaacaagcaaaagcaagcccagctctggta
gccaaggatcctggtactgtggctaacaaaaaagaagaagaagatttagcgaaagccatt
gagttgtcgctgaaggaacaaaggcagcagtcaaccaccctttccagtttgtatccaagc
acatctaatctcttaactaaccaccaacacgaaggccgaaaagttcgtgctatatacgac
tttgaagctgctgaagataacgaacttacttttaaagctggagaaattattacagttctt
gatgacagtgaccccaactggtggaagggtgaaactcatcaaggcatggggttattcccc
tctaattttgtgactgcggatctcactgctgaaccagaaatgattaaaacggagaagaag
acggtacaatttagtgacgatgttcaggtagaaacgatagaaccagagccggaacaagcc
tacattgatgaagataaaatggaccaactgctacagatgttgcaaagtacggatcccagt
gatgatcaaccagatcttcccgagttacttcatcttgaagccatgtgtcaccagatgggg
cctctcattgatgagaagctggaagatattgacagaaaacattcagaactctcagagctc
aatgttaaagtgatggaggccctgtccttgtataccaagttaatgaatgaagatccaatg
tattccatgtatgcaaaattacagaatcagcagtattacattcagtcatctggtgtttct
ggttctcaggtgtacccgggccctcctcaaagcggtgcctacctggtcgcagggagcgcg
cagctgagccagccccagagctacagccttcccccagagcagctgtcttctctcagccaa
ggagctgtgctgtctgccagcccagcccttcctagtcagcaggctcaggcttcctacccc
aacacgatgggcacttccgttcaaggaggcacgtatcccagccaggcttcagtgtatagt
cctcctcctgccgcccccgacgtcaccatataccagaacgcagggagcagcctatcccag
gtgccgaactatactttaacatcggcgctgccccagccgcctccgccccagcagccgtac
tctccgaaggccctgctgtag

DBGET integrated database retrieval system