KEGG   Delphinapterus leucas (beluga whale): 111172895
Entry
111172895         CDS       T05885                                 

Gene name
HOXD10
Definition
(RefSeq) homeobox protein Hox-D10
  KO
K09295  homrobox protein Hox-D10
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111172895 (HOXD10)
   05205 Proteoglycans in cancer
    111172895 (HOXD10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111172895 (HOXD10)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    111172895 (HOXD10)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 111172895
NCBI-ProteinID: XP_022425794
UniProt: A0A2Y9MTU4
LinkDB
Position
Unknown
AA seq 340 aa
MSFPNSSPAANTFLVDSLISACRSDSFYSSSAGMYMPPPSADMGTYGMQTCGLLPSLAKR
EVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKR
NKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQL
NPRGAGKPQLSAAQLQMEKKMNEPASGQEPAKVSQVESPEAKGGLPEERSCLAEVSVSSP
EVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEIS
KSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtcctttcccaacagctctcctgctgctaatacttttttagtagattccttgatcagt
gcctgcaggagtgacagtttttattcgagcagcgccggcatgtacatgccaccacctagc
gcagacatggggacctatggaatgcaaacctgtggactactcccgtctctggccaaaaga
gaagtgaaccaccaaaatatgggtatgaatgtgcatccgtatatacctcaagtagacagt
tggacagacccgaacagatcttgtcgaatagagcaacctgttacacagcaagtccctact
tgctccttcaccaccaacattaaggaagaatccaattgctgcatgtattctgataagcgc
aacaaactcatttctgctgaggtcccttcgtaccagaggctggtccctgagtcctgtccc
gttgagaaccctgaggttcctgtccctggatattttagactgagtcagacctacgccacc
gggaaaacccaagagtacaataacagccccgaaggcagctccacagtcatgctccagctc
aaccctcgcggcgcgggcaagccgcagctctcggccgcccagctgcagatggaaaagaag
atgaacgagcccgcaagtggccaggagcctgccaaagtctcccaggtggagagccccgag
gccaagggcggccttccagaagagaggagctgcctggctgaggtctccgtgtccagtccc
gaagtacaggagaaggaaagcaaagaggaaatcaagtctgatactccaaccagcaattgg
ctcactgcaaagagtggcagaaagaagaggtgcccttacactaagcaccaaacgctggaa
ttagaaaaagagttcttgttcaatatgtacctcacccgcgagcgccgcctagagatcagt
aagagcgttaacctcaccgacaggcaggtcaagatttggtttcaaaaccgccgaatgaaa
ctcaagaagatgagccgagagaaccggatccgagaactgaccgccaacctcaccttctct
tag

DBGET integrated database retrieval system