Delphinapterus leucas (beluga whale): 111172911 Help Entry 111172911         CDS       T05885                                  Definition (RefSeq) cytochrome c 2   KO K08738   cytochrome c Organism dle  Delphinapterus leucas (beluga whale) Pathway dle01524   Platinum drug resistance dle04115   p53 signaling pathway dle04210   Apoptosis dle04215   Apoptosis - multiple species dle04932   Non-alcoholic fatty liver disease dle05010   Alzheimer disease dle05012   Parkinson disease dle05014   Amyotrophic lateral sclerosis dle05016   Huntington disease dle05017   Spinocerebellar ataxia dle05020   Prion disease dle05022   Pathways of neurodegeneration - multiple diseases dle05132   Salmonella infection dle05134   Legionellosis dle05145   Toxoplasmosis dle05152   Tuberculosis dle05160   Hepatitis C dle05161   Hepatitis B dle05162   Measles dle05163   Human cytomegalovirus infection dle05164   Influenza A dle05167   Kaposi sarcoma-associated herpesvirus infection dle05168   Herpes simplex virus 1 infection dle05169   Epstein-Barr virus infection dle05170   Human immunodeficiency virus 1 infection dle05200   Pathways in cancer dle05210   Colorectal cancer dle05222   Small cell lung cancer dle05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:dle00001]  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     111172911    04215 Apoptosis - multiple species     111172911    04115 p53 signaling pathway     111172911  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111172911   09162 Cancer: specific types    05210 Colorectal cancer     111172911    05222 Small cell lung cancer     111172911   09164 Neurodegenerative disease    05010 Alzheimer disease     111172911    05012 Parkinson disease     111172911    05014 Amyotrophic lateral sclerosis     111172911    05016 Huntington disease     111172911    05017 Spinocerebellar ataxia     111172911    05020 Prion disease     111172911    05022 Pathways of neurodegeneration - multiple diseases     111172911   09166 Cardiovascular disease    05416 Viral myocarditis     111172911   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     111172911   09171 Infectious disease: bacterial    05132 Salmonella infection     111172911    05134 Legionellosis     111172911    05152 Tuberculosis     111172911   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     111172911    05161 Hepatitis B     111172911    05160 Hepatitis C     111172911    05164 Influenza A     111172911    05162 Measles     111172911    05168 Herpes simplex virus 1 infection     111172911    05163 Human cytomegalovirus infection     111172911    05167 Kaposi sarcoma-associated herpesvirus infection     111172911    05169 Epstein-Barr virus infection     111172911   09174 Infectious disease: parasitic    05145 Toxoplasmosis     111172911   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     111172911 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Motif Other DBs NCBI-GeneID:  111172911 NCBI-ProteinID:  XP_022425828 UniProt:  A0A2Y9N9A4 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MANAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGVFGRKTGQAPGFSYTIANKNKGVIW GEETLMEYLENPKKYIPGTKMVFAGLKKKSEREDLIEYLKQATSS NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggcaaatgctgaggcaggcaagaagatctttgttcaaaaatgtgctcagtgccacaca gtggaaaaaggtggaaaacacaaaactggtccaaacctctggggcgtttttggcagaaaa acaggacaagcaccaggattttcttataccattgcaaacaaaaacaaaggtgttatctgg ggagaggagactctgatggaatatttggagaacccaaaaaaatatatccctggaactaaa atggtctttgccggtcttaaaaagaagagtgagagagaagatcttattgagtatttgaaa caggcaacatcctcatga

Delphinapterus leucas (beluga whale): 111174031 Help Entry 111174031         CDS       T05885                                  Definition (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism dle  Delphinapterus leucas (beluga whale) Pathway dle01524   Platinum drug resistance dle04115   p53 signaling pathway dle04210   Apoptosis dle04215   Apoptosis - multiple species dle04932   Non-alcoholic fatty liver disease dle05010   Alzheimer disease dle05012   Parkinson disease dle05014   Amyotrophic lateral sclerosis dle05016   Huntington disease dle05017   Spinocerebellar ataxia dle05020   Prion disease dle05022   Pathways of neurodegeneration - multiple diseases dle05132   Salmonella infection dle05134   Legionellosis dle05145   Toxoplasmosis dle05152   Tuberculosis dle05160   Hepatitis C dle05161   Hepatitis B dle05162   Measles dle05163   Human cytomegalovirus infection dle05164   Influenza A dle05167   Kaposi sarcoma-associated herpesvirus infection dle05168   Herpes simplex virus 1 infection dle05169   Epstein-Barr virus infection dle05170   Human immunodeficiency virus 1 infection dle05200   Pathways in cancer dle05210   Colorectal cancer dle05222   Small cell lung cancer dle05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:dle00001]  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     111174031    04215 Apoptosis - multiple species     111174031    04115 p53 signaling pathway     111174031  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111174031   09162 Cancer: specific types    05210 Colorectal cancer     111174031    05222 Small cell lung cancer     111174031   09164 Neurodegenerative disease    05010 Alzheimer disease     111174031    05012 Parkinson disease     111174031    05014 Amyotrophic lateral sclerosis     111174031    05016 Huntington disease     111174031    05017 Spinocerebellar ataxia     111174031    05020 Prion disease     111174031    05022 Pathways of neurodegeneration - multiple diseases     111174031   09166 Cardiovascular disease    05416 Viral myocarditis     111174031   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     111174031   09171 Infectious disease: bacterial    05132 Salmonella infection     111174031    05134 Legionellosis     111174031    05152 Tuberculosis     111174031   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     111174031    05161 Hepatitis B     111174031    05160 Hepatitis C     111174031    05164 Influenza A     111174031    05162 Measles     111174031    05168 Herpes simplex virus 1 infection     111174031    05163 Human cytomegalovirus infection     111174031    05167 Kaposi sarcoma-associated herpesvirus infection     111174031    05169 Epstein-Barr virus infection     111174031   09174 Infectious disease: parasitic    05145 Toxoplasmosis     111174031   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     111174031 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Motif Other DBs NCBI-GeneID:  111174031 NCBI-ProteinID:  XP_022427963 UniProt:  A0A2Y9NFC7 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLRGLLGRKTGQPVGFSYTDANKNKGITG GEEALMECLENPKKYIPGTKMIFAGIKRKGERAVLIAYLKKANA NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact gtggaaaagggaggcaagcacaagactgggccaaatctccgtggtctgttggggcgaaag acaggtcagcctgtcggattctcttacactgatgccaacaagaacaaaggcatcaccggg ggagaggaggcactgatggagtgtttggagaatcccaagaagtacatccctggaacaaaa atgatcttcgctggcattaagaggaagggagaaagggcagtcttgatagcttatctcaaa aaagctaatgcgtaa

Delphinapterus leucas (beluga whale): 111174197 Help Entry 111174197         CDS       T05885                                  Definition (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism dle  Delphinapterus leucas (beluga whale) Pathway dle01524   Platinum drug resistance dle04115   p53 signaling pathway dle04210   Apoptosis dle04215   Apoptosis - multiple species dle04932   Non-alcoholic fatty liver disease dle05010   Alzheimer disease dle05012   Parkinson disease dle05014   Amyotrophic lateral sclerosis dle05016   Huntington disease dle05017   Spinocerebellar ataxia dle05020   Prion disease dle05022   Pathways of neurodegeneration - multiple diseases dle05132   Salmonella infection dle05134   Legionellosis dle05145   Toxoplasmosis dle05152   Tuberculosis dle05160   Hepatitis C dle05161   Hepatitis B dle05162   Measles dle05163   Human cytomegalovirus infection dle05164   Influenza A dle05167   Kaposi sarcoma-associated herpesvirus infection dle05168   Herpes simplex virus 1 infection dle05169   Epstein-Barr virus infection dle05170   Human immunodeficiency virus 1 infection dle05200   Pathways in cancer dle05210   Colorectal cancer dle05222   Small cell lung cancer dle05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:dle00001]  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     111174197    04215 Apoptosis - multiple species     111174197    04115 p53 signaling pathway     111174197  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111174197   09162 Cancer: specific types    05210 Colorectal cancer     111174197    05222 Small cell lung cancer     111174197   09164 Neurodegenerative disease    05010 Alzheimer disease     111174197    05012 Parkinson disease     111174197    05014 Amyotrophic lateral sclerosis     111174197    05016 Huntington disease     111174197    05017 Spinocerebellar ataxia     111174197    05020 Prion disease     111174197    05022 Pathways of neurodegeneration - multiple diseases     111174197   09166 Cardiovascular disease    05416 Viral myocarditis     111174197   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     111174197   09171 Infectious disease: bacterial    05132 Salmonella infection     111174197    05134 Legionellosis     111174197    05152 Tuberculosis     111174197   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     111174197    05161 Hepatitis B     111174197    05160 Hepatitis C     111174197    05164 Influenza A     111174197    05162 Measles     111174197    05168 Herpes simplex virus 1 infection     111174197    05163 Human cytomegalovirus infection     111174197    05167 Kaposi sarcoma-associated herpesvirus infection     111174197    05169 Epstein-Barr virus infection     111174197   09174 Infectious disease: parasitic    05145 Toxoplasmosis     111174197   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     111174197 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Motif Other DBs NCBI-GeneID:  111174197 NCBI-ProteinID:  XP_022428293 UniProt:  A0A2Y9NG78 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search VEKGEKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYIDANKNKGITWGEE TLMEYLENPKKYIPGTKTIFAGIKKKGERADLIAYLQKATNE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt gttgagaagggagagaagatttttgttcagaagtgcgcccagtgccatactgtggaaaag ggaggcaagcacaagactgggccaaatctccatggcctgtttgggcgaaagacaggtcag gctgtcggattctcttacatagatgccaacaagaacaaaggcatcacctggggagaggag acactgatggagtatttggagaatcccaagaagtacatccctggaacaaaaacgatcttc gctggcattaagaagaagggagaaagggcagacttgatagcttatctccaaaaagctact aatgagtaa

Delphinapterus leucas (beluga whale): 111174575 Help Entry 111174575         CDS       T05885                                  Definition (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism dle  Delphinapterus leucas (beluga whale) Pathway dle01524   Platinum drug resistance dle04115   p53 signaling pathway dle04210   Apoptosis dle04215   Apoptosis - multiple species dle04932   Non-alcoholic fatty liver disease dle05010   Alzheimer disease dle05012   Parkinson disease dle05014   Amyotrophic lateral sclerosis dle05016   Huntington disease dle05017   Spinocerebellar ataxia dle05020   Prion disease dle05022   Pathways of neurodegeneration - multiple diseases dle05132   Salmonella infection dle05134   Legionellosis dle05145   Toxoplasmosis dle05152   Tuberculosis dle05160   Hepatitis C dle05161   Hepatitis B dle05162   Measles dle05163   Human cytomegalovirus infection dle05164   Influenza A dle05167   Kaposi sarcoma-associated herpesvirus infection dle05168   Herpes simplex virus 1 infection dle05169   Epstein-Barr virus infection dle05170   Human immunodeficiency virus 1 infection dle05200   Pathways in cancer dle05210   Colorectal cancer dle05222   Small cell lung cancer dle05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:dle00001]  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     111174575    04215 Apoptosis - multiple species     111174575    04115 p53 signaling pathway     111174575  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111174575   09162 Cancer: specific types    05210 Colorectal cancer     111174575    05222 Small cell lung cancer     111174575   09164 Neurodegenerative disease    05010 Alzheimer disease     111174575    05012 Parkinson disease     111174575    05014 Amyotrophic lateral sclerosis     111174575    05016 Huntington disease     111174575    05017 Spinocerebellar ataxia     111174575    05020 Prion disease     111174575    05022 Pathways of neurodegeneration - multiple diseases     111174575   09166 Cardiovascular disease    05416 Viral myocarditis     111174575   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     111174575   09171 Infectious disease: bacterial    05132 Salmonella infection     111174575    05134 Legionellosis     111174575    05152 Tuberculosis     111174575   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     111174575    05161 Hepatitis B     111174575    05160 Hepatitis C     111174575    05164 Influenza A     111174575    05162 Measles     111174575    05168 Herpes simplex virus 1 infection     111174575    05163 Human cytomegalovirus infection     111174575    05167 Kaposi sarcoma-associated herpesvirus infection     111174575    05169 Epstein-Barr virus infection     111174575   09174 Infectious disease: parasitic    05145 Toxoplasmosis     111174575   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     111174575 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  111174575 NCBI-ProteinID:  XP_022429180 UniProt:  A0A2Y9N4M1 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MEKRGKHKTGPNLHGLFGQKTGQAPGFSYTDASKNKGISWGEETLMGYMENPKKYIPGTK MIFTGIRRG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaaaagagaggcaagcacaagactgggccaaatctccatggtctgtttgggcaaaag acaggtcaggcccctggattttcttacacagatgccagcaagaacaaaggcatctcttgg ggagaggagacactgatggggtatatggagaatcccaagaagtacatccctggaacaaaa atgattttcacaggcattagaaggggctga

Delphinapterus leucas (beluga whale): 111175930 Help Entry 111175930         CDS       T05885                                  Definition (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism dle  Delphinapterus leucas (beluga whale) Pathway dle01524   Platinum drug resistance dle04115   p53 signaling pathway dle04210   Apoptosis dle04215   Apoptosis - multiple species dle04932   Non-alcoholic fatty liver disease dle05010   Alzheimer disease dle05012   Parkinson disease dle05014   Amyotrophic lateral sclerosis dle05016   Huntington disease dle05017   Spinocerebellar ataxia dle05020   Prion disease dle05022   Pathways of neurodegeneration - multiple diseases dle05132   Salmonella infection dle05134   Legionellosis dle05145   Toxoplasmosis dle05152   Tuberculosis dle05160   Hepatitis C dle05161   Hepatitis B dle05162   Measles dle05163   Human cytomegalovirus infection dle05164   Influenza A dle05167   Kaposi sarcoma-associated herpesvirus infection dle05168   Herpes simplex virus 1 infection dle05169   Epstein-Barr virus infection dle05170   Human immunodeficiency virus 1 infection dle05200   Pathways in cancer dle05210   Colorectal cancer dle05222   Small cell lung cancer dle05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:dle00001]  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     111175930    04215 Apoptosis - multiple species     111175930    04115 p53 signaling pathway     111175930  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111175930   09162 Cancer: specific types    05210 Colorectal cancer     111175930    05222 Small cell lung cancer     111175930   09164 Neurodegenerative disease    05010 Alzheimer disease     111175930    05012 Parkinson disease     111175930    05014 Amyotrophic lateral sclerosis     111175930    05016 Huntington disease     111175930    05017 Spinocerebellar ataxia     111175930    05020 Prion disease     111175930    05022 Pathways of neurodegeneration - multiple diseases     111175930   09166 Cardiovascular disease    05416 Viral myocarditis     111175930   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     111175930   09171 Infectious disease: bacterial    05132 Salmonella infection     111175930    05134 Legionellosis     111175930    05152 Tuberculosis     111175930   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     111175930    05161 Hepatitis B     111175930    05160 Hepatitis C     111175930    05164 Influenza A     111175930    05162 Measles     111175930    05168 Herpes simplex virus 1 infection     111175930    05163 Human cytomegalovirus infection     111175930    05167 Kaposi sarcoma-associated herpesvirus infection     111175930    05169 Epstein-Barr virus infection     111175930   09174 Infectious disease: parasitic    05145 Toxoplasmosis     111175930   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     111175930 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 DDE_Tnp_1 UPF0128 Motif Other DBs NCBI-GeneID:  111175930 NCBI-ProteinID:  XP_022431567 UniProt:  A0A2Y9NJJ5 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDVEEGKKISVQKCAQCHTVEKGGKHKTGPNLHGLFGQKTGQAVGFSYTDANKNEGITW GEETLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNA NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgaggagggcaagaagatttctgttcagaagtgtgcccagtgccatact gtggaaaagggaggcaagcacaagactgggccaaatctccatggtctgtttgggcaaaag acaggtcaggctgtcggattctcttacacagatgccaacaagaacgaaggcatcacctgg ggagaggagacgctgatggagtatttggagaatcccaagaagtacatccctggaacaaaa atgatcttcgctggcattaagaagaagggagaaagggcagacttgatagcgtatctcaaa aaagctactaatgcataa

Delphinapterus leucas (beluga whale): 111180543 Help Entry 111180543         CDS       T05885                                  Definition (RefSeq) cytochrome c   KO K08738   cytochrome c Organism dle  Delphinapterus leucas (beluga whale) Pathway dle01524   Platinum drug resistance dle04115   p53 signaling pathway dle04210   Apoptosis dle04215   Apoptosis - multiple species dle04932   Non-alcoholic fatty liver disease dle05010   Alzheimer disease dle05012   Parkinson disease dle05014   Amyotrophic lateral sclerosis dle05016   Huntington disease dle05017   Spinocerebellar ataxia dle05020   Prion disease dle05022   Pathways of neurodegeneration - multiple diseases dle05132   Salmonella infection dle05134   Legionellosis dle05145   Toxoplasmosis dle05152   Tuberculosis dle05160   Hepatitis C dle05161   Hepatitis B dle05162   Measles dle05163   Human cytomegalovirus infection dle05164   Influenza A dle05167   Kaposi sarcoma-associated herpesvirus infection dle05168   Herpes simplex virus 1 infection dle05169   Epstein-Barr virus infection dle05170   Human immunodeficiency virus 1 infection dle05200   Pathways in cancer dle05210   Colorectal cancer dle05222   Small cell lung cancer dle05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:dle00001]  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     111180543    04215 Apoptosis - multiple species     111180543    04115 p53 signaling pathway     111180543  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111180543   09162 Cancer: specific types    05210 Colorectal cancer     111180543    05222 Small cell lung cancer     111180543   09164 Neurodegenerative disease    05010 Alzheimer disease     111180543    05012 Parkinson disease     111180543    05014 Amyotrophic lateral sclerosis     111180543    05016 Huntington disease     111180543    05017 Spinocerebellar ataxia     111180543    05020 Prion disease     111180543    05022 Pathways of neurodegeneration - multiple diseases     111180543   09166 Cardiovascular disease    05416 Viral myocarditis     111180543   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     111180543   09171 Infectious disease: bacterial    05132 Salmonella infection     111180543    05134 Legionellosis     111180543    05152 Tuberculosis     111180543   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     111180543    05161 Hepatitis B     111180543    05160 Hepatitis C     111180543    05164 Influenza A     111180543    05162 Measles     111180543    05168 Herpes simplex virus 1 infection     111180543    05163 Human cytomegalovirus infection     111180543    05167 Kaposi sarcoma-associated herpesvirus infection     111180543    05169 Epstein-Barr virus infection     111180543   09174 Infectious disease: parasitic    05145 Toxoplasmosis     111180543   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     111180543 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128 Motif Other DBs NCBI-GeneID:  111180543 NCBI-ProteinID:  XP_022440632 UniProt:  A0A2Y9PBF7 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MCDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW GEETLMEYLENPKKYIPGTKMIFAGIKKKSERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgtgtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact gtggaaaagggaggcaagcacaagactgggccaaatctccatggtctgtttgggcgaaag acaggtcaggctgtcggattctcttacacagatgccaacaagaacaaaggcatcacctgg ggagaggagacgctgatggagtatttggagaatcccaagaagtacatccctggaacaaaa atgatcttcgctggcattaagaagaagtcagaaagggcagacttgatagcttatctcaaa aaagctactaatgagtaa

DBGET integrated database retrieval system