KEGG   Delphinapterus leucas (beluga whale): 111172911
Entry
111172911         CDS       T05885                                 

Definition
(RefSeq) cytochrome c 2
  KO
K08738  cytochrome c
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle04115  p53 signaling pathway
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04932  Non-alcoholic fatty liver disease
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05014  Amyotrophic lateral sclerosis
dle05016  Huntington disease
dle05017  Spinocerebellar ataxia
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05134  Legionellosis
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05222  Small cell lung cancer
dle05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111172911
   04215 Apoptosis - multiple species
    111172911
   04115 p53 signaling pathway
    111172911
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111172911
  09162 Cancer: specific types
   05210 Colorectal cancer
    111172911
   05222 Small cell lung cancer
    111172911
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111172911
   05012 Parkinson disease
    111172911
   05014 Amyotrophic lateral sclerosis
    111172911
   05016 Huntington disease
    111172911
   05017 Spinocerebellar ataxia
    111172911
   05020 Prion disease
    111172911
   05022 Pathways of neurodegeneration - multiple diseases
    111172911
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111172911
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111172911
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111172911
   05134 Legionellosis
    111172911
   05152 Tuberculosis
    111172911
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111172911
   05161 Hepatitis B
    111172911
   05160 Hepatitis C
    111172911
   05164 Influenza A
    111172911
   05162 Measles
    111172911
   05168 Herpes simplex virus 1 infection
    111172911
   05163 Human cytomegalovirus infection
    111172911
   05167 Kaposi sarcoma-associated herpesvirus infection
    111172911
   05169 Epstein-Barr virus infection
    111172911
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111172911
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111172911
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 111172911
NCBI-ProteinID: XP_022425828
UniProt: A0A2Y9N9A4
LinkDB
Position
Unknown
AA seq 105 aa
MANAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGVFGRKTGQAPGFSYTIANKNKGVIW
GEETLMEYLENPKKYIPGTKMVFAGLKKKSEREDLIEYLKQATSS
NT seq 318 nt   +upstreamnt  +downstreamnt
atggcaaatgctgaggcaggcaagaagatctttgttcaaaaatgtgctcagtgccacaca
gtggaaaaaggtggaaaacacaaaactggtccaaacctctggggcgtttttggcagaaaa
acaggacaagcaccaggattttcttataccattgcaaacaaaaacaaaggtgttatctgg
ggagaggagactctgatggaatatttggagaacccaaaaaaatatatccctggaactaaa
atggtctttgccggtcttaaaaagaagagtgagagagaagatcttattgagtatttgaaa
caggcaacatcctcatga

KEGG   Delphinapterus leucas (beluga whale): 111174031
Entry
111174031         CDS       T05885                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle04115  p53 signaling pathway
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04932  Non-alcoholic fatty liver disease
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05014  Amyotrophic lateral sclerosis
dle05016  Huntington disease
dle05017  Spinocerebellar ataxia
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05134  Legionellosis
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05222  Small cell lung cancer
dle05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111174031
   04215 Apoptosis - multiple species
    111174031
   04115 p53 signaling pathway
    111174031
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111174031
  09162 Cancer: specific types
   05210 Colorectal cancer
    111174031
   05222 Small cell lung cancer
    111174031
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111174031
   05012 Parkinson disease
    111174031
   05014 Amyotrophic lateral sclerosis
    111174031
   05016 Huntington disease
    111174031
   05017 Spinocerebellar ataxia
    111174031
   05020 Prion disease
    111174031
   05022 Pathways of neurodegeneration - multiple diseases
    111174031
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111174031
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111174031
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111174031
   05134 Legionellosis
    111174031
   05152 Tuberculosis
    111174031
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111174031
   05161 Hepatitis B
    111174031
   05160 Hepatitis C
    111174031
   05164 Influenza A
    111174031
   05162 Measles
    111174031
   05168 Herpes simplex virus 1 infection
    111174031
   05163 Human cytomegalovirus infection
    111174031
   05167 Kaposi sarcoma-associated herpesvirus infection
    111174031
   05169 Epstein-Barr virus infection
    111174031
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111174031
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111174031
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 111174031
NCBI-ProteinID: XP_022427963
UniProt: A0A2Y9NFC7
LinkDB
Position
Unknown
AA seq 104 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLRGLLGRKTGQPVGFSYTDANKNKGITG
GEEALMECLENPKKYIPGTKMIFAGIKRKGERAVLIAYLKKANA
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaatctccgtggtctgttggggcgaaag
acaggtcagcctgtcggattctcttacactgatgccaacaagaacaaaggcatcaccggg
ggagaggaggcactgatggagtgtttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaggaagggagaaagggcagtcttgatagcttatctcaaa
aaagctaatgcgtaa

KEGG   Delphinapterus leucas (beluga whale): 111174197
Entry
111174197         CDS       T05885                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle04115  p53 signaling pathway
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04932  Non-alcoholic fatty liver disease
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05014  Amyotrophic lateral sclerosis
dle05016  Huntington disease
dle05017  Spinocerebellar ataxia
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05134  Legionellosis
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05222  Small cell lung cancer
dle05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111174197
   04215 Apoptosis - multiple species
    111174197
   04115 p53 signaling pathway
    111174197
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111174197
  09162 Cancer: specific types
   05210 Colorectal cancer
    111174197
   05222 Small cell lung cancer
    111174197
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111174197
   05012 Parkinson disease
    111174197
   05014 Amyotrophic lateral sclerosis
    111174197
   05016 Huntington disease
    111174197
   05017 Spinocerebellar ataxia
    111174197
   05020 Prion disease
    111174197
   05022 Pathways of neurodegeneration - multiple diseases
    111174197
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111174197
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111174197
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111174197
   05134 Legionellosis
    111174197
   05152 Tuberculosis
    111174197
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111174197
   05161 Hepatitis B
    111174197
   05160 Hepatitis C
    111174197
   05164 Influenza A
    111174197
   05162 Measles
    111174197
   05168 Herpes simplex virus 1 infection
    111174197
   05163 Human cytomegalovirus infection
    111174197
   05167 Kaposi sarcoma-associated herpesvirus infection
    111174197
   05169 Epstein-Barr virus infection
    111174197
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111174197
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111174197
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 111174197
NCBI-ProteinID: XP_022428293
UniProt: A0A2Y9NG78
LinkDB
Position
Unknown
AA seq 102 aa
VEKGEKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYIDANKNKGITWGEE
TLMEYLENPKKYIPGTKTIFAGIKKKGERADLIAYLQKATNE
NT seq 309 nt   +upstreamnt  +downstreamnt
gttgagaagggagagaagatttttgttcagaagtgcgcccagtgccatactgtggaaaag
ggaggcaagcacaagactgggccaaatctccatggcctgtttgggcgaaagacaggtcag
gctgtcggattctcttacatagatgccaacaagaacaaaggcatcacctggggagaggag
acactgatggagtatttggagaatcccaagaagtacatccctggaacaaaaacgatcttc
gctggcattaagaagaagggagaaagggcagacttgatagcttatctccaaaaagctact
aatgagtaa

KEGG   Delphinapterus leucas (beluga whale): 111174575
Entry
111174575         CDS       T05885                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle04115  p53 signaling pathway
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04932  Non-alcoholic fatty liver disease
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05014  Amyotrophic lateral sclerosis
dle05016  Huntington disease
dle05017  Spinocerebellar ataxia
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05134  Legionellosis
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05222  Small cell lung cancer
dle05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111174575
   04215 Apoptosis - multiple species
    111174575
   04115 p53 signaling pathway
    111174575
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111174575
  09162 Cancer: specific types
   05210 Colorectal cancer
    111174575
   05222 Small cell lung cancer
    111174575
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111174575
   05012 Parkinson disease
    111174575
   05014 Amyotrophic lateral sclerosis
    111174575
   05016 Huntington disease
    111174575
   05017 Spinocerebellar ataxia
    111174575
   05020 Prion disease
    111174575
   05022 Pathways of neurodegeneration - multiple diseases
    111174575
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111174575
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111174575
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111174575
   05134 Legionellosis
    111174575
   05152 Tuberculosis
    111174575
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111174575
   05161 Hepatitis B
    111174575
   05160 Hepatitis C
    111174575
   05164 Influenza A
    111174575
   05162 Measles
    111174575
   05168 Herpes simplex virus 1 infection
    111174575
   05163 Human cytomegalovirus infection
    111174575
   05167 Kaposi sarcoma-associated herpesvirus infection
    111174575
   05169 Epstein-Barr virus infection
    111174575
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111174575
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111174575
SSDB
Other DBs
NCBI-GeneID: 111174575
NCBI-ProteinID: XP_022429180
UniProt: A0A2Y9N4M1
LinkDB
Position
Unknown
AA seq 69 aa
MEKRGKHKTGPNLHGLFGQKTGQAPGFSYTDASKNKGISWGEETLMGYMENPKKYIPGTK
MIFTGIRRG
NT seq 210 nt   +upstreamnt  +downstreamnt
atggaaaagagaggcaagcacaagactgggccaaatctccatggtctgtttgggcaaaag
acaggtcaggcccctggattttcttacacagatgccagcaagaacaaaggcatctcttgg
ggagaggagacactgatggggtatatggagaatcccaagaagtacatccctggaacaaaa
atgattttcacaggcattagaaggggctga

KEGG   Delphinapterus leucas (beluga whale): 111175930
Entry
111175930         CDS       T05885                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle04115  p53 signaling pathway
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04932  Non-alcoholic fatty liver disease
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05014  Amyotrophic lateral sclerosis
dle05016  Huntington disease
dle05017  Spinocerebellar ataxia
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05134  Legionellosis
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05222  Small cell lung cancer
dle05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111175930
   04215 Apoptosis - multiple species
    111175930
   04115 p53 signaling pathway
    111175930
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111175930
  09162 Cancer: specific types
   05210 Colorectal cancer
    111175930
   05222 Small cell lung cancer
    111175930
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111175930
   05012 Parkinson disease
    111175930
   05014 Amyotrophic lateral sclerosis
    111175930
   05016 Huntington disease
    111175930
   05017 Spinocerebellar ataxia
    111175930
   05020 Prion disease
    111175930
   05022 Pathways of neurodegeneration - multiple diseases
    111175930
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111175930
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111175930
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111175930
   05134 Legionellosis
    111175930
   05152 Tuberculosis
    111175930
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111175930
   05161 Hepatitis B
    111175930
   05160 Hepatitis C
    111175930
   05164 Influenza A
    111175930
   05162 Measles
    111175930
   05168 Herpes simplex virus 1 infection
    111175930
   05163 Human cytomegalovirus infection
    111175930
   05167 Kaposi sarcoma-associated herpesvirus infection
    111175930
   05169 Epstein-Barr virus infection
    111175930
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111175930
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111175930
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 DDE_Tnp_1 UPF0128
Other DBs
NCBI-GeneID: 111175930
NCBI-ProteinID: XP_022431567
UniProt: A0A2Y9NJJ5
LinkDB
Position
Unknown
AA seq 105 aa
MGDVEEGKKISVQKCAQCHTVEKGGKHKTGPNLHGLFGQKTGQAVGFSYTDANKNEGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNA
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgaggagggcaagaagatttctgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaatctccatggtctgtttgggcaaaag
acaggtcaggctgtcggattctcttacacagatgccaacaagaacgaaggcatcacctgg
ggagaggagacgctgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaagaagggagaaagggcagacttgatagcgtatctcaaa
aaagctactaatgcataa

KEGG   Delphinapterus leucas (beluga whale): 111180543
Entry
111180543         CDS       T05885                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle04115  p53 signaling pathway
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04932  Non-alcoholic fatty liver disease
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05014  Amyotrophic lateral sclerosis
dle05016  Huntington disease
dle05017  Spinocerebellar ataxia
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05134  Legionellosis
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05222  Small cell lung cancer
dle05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111180543
   04215 Apoptosis - multiple species
    111180543
   04115 p53 signaling pathway
    111180543
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111180543
  09162 Cancer: specific types
   05210 Colorectal cancer
    111180543
   05222 Small cell lung cancer
    111180543
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111180543
   05012 Parkinson disease
    111180543
   05014 Amyotrophic lateral sclerosis
    111180543
   05016 Huntington disease
    111180543
   05017 Spinocerebellar ataxia
    111180543
   05020 Prion disease
    111180543
   05022 Pathways of neurodegeneration - multiple diseases
    111180543
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111180543
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111180543
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111180543
   05134 Legionellosis
    111180543
   05152 Tuberculosis
    111180543
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111180543
   05161 Hepatitis B
    111180543
   05160 Hepatitis C
    111180543
   05164 Influenza A
    111180543
   05162 Measles
    111180543
   05168 Herpes simplex virus 1 infection
    111180543
   05163 Human cytomegalovirus infection
    111180543
   05167 Kaposi sarcoma-associated herpesvirus infection
    111180543
   05169 Epstein-Barr virus infection
    111180543
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111180543
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111180543
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 111180543
NCBI-ProteinID: XP_022440632
UniProt: A0A2Y9PBF7
LinkDB
Position
Unknown
AA seq 105 aa
MCDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKKSERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgtgtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaatctccatggtctgtttgggcgaaag
acaggtcaggctgtcggattctcttacacagatgccaacaagaacaaaggcatcacctgg
ggagaggagacgctgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaagaagtcagaaagggcagacttgatagcttatctcaaa
aaagctactaatgagtaa

DBGET integrated database retrieval system