KEGG   Delphinapterus leucas (beluga whale): 111173064
Entry
111173064         CDS       T05885                                 

Gene name
MAX
Definition
(RefSeq) protein max isoform X1
  KO
K04453  Max protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111173064 (MAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111173064 (MAX)
   05202 Transcriptional misregulation in cancer
    111173064 (MAX)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111173064 (MAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111173064 (MAX)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    111173064 (MAX)
SSDB
Motif
Pfam: HLH DUF5716 Jnk-SapK_ap_N bZIP_2 SlyX Filament DUF5595 ZapB SLX9 DUF4763 Csm1_N
Other DBs
NCBI-GeneID: 111173064
NCBI-ProteinID: XP_022426061
UniProt: A0A2Y9MYS7
LinkDB
Position
Unknown
AA seq 162 aa
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKQQA
SRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSS
DNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatca
gcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa
gacagctttcacagtttgcgggactcggtcccatcactccaaggagagaagcaacaggca
tcccgggcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaac
cacacacaccagcaagatattgatgacctcaagcggcagaatgctcttctggagcagcaa
gtccgtgcactggagaaggcgaggtcgagtgcccaactgcagaccaactacccctcctca
gacaacagcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctca
gactccagctcggagtcggagcccgaagagccccaaagcaggaagaagctccggatggag
gccagctaa

DBGET integrated database retrieval system