KEGG   Delphinapterus leucas (beluga whale): 111173087
Entry
111173087         CDS       T05885                                 

Gene name
HIF1A
Definition
(RefSeq) hypoxia-inducible factor 1-alpha isoform X1
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04066  HIF-1 signaling pathway
dle04137  Mitophagy - animal
dle04140  Autophagy - animal
dle04659  Th17 cell differentiation
dle04919  Thyroid hormone signaling pathway
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05211  Renal cell carcinoma
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    111173087 (HIF1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111173087 (HIF1A)
   04137 Mitophagy - animal
    111173087 (HIF1A)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111173087 (HIF1A)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111173087 (HIF1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111173087 (HIF1A)
   05205 Proteoglycans in cancer
    111173087 (HIF1A)
   05230 Central carbon metabolism in cancer
    111173087 (HIF1A)
   05231 Choline metabolism in cancer
    111173087 (HIF1A)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111173087 (HIF1A)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    111173087 (HIF1A)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111173087 (HIF1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111173087 (HIF1A)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    111173087 (HIF1A)
SSDB
Motif
Pfam: PAS_3 HIF-1a_CTAD PAS_11 HIF-1 PAS PAS_9 PAS_4 HLH DDRGK
Other DBs
NCBI-GeneID: 111173087
NCBI-ProteinID: XP_022426136
UniProt: A0A2Y9MZ41
LinkDB
Position
Unknown
AA seq 823 aa
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNSNQSQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV
LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET
DEQQLEEVPLYNDVMLPSSNEKLQNINLAMSPLPASETPKPLRSSADPALNQEVALKLEP
NPESLELSFTMPQIQDQPASPSDGSTRQSSPEPNSPSEYCFDVDSDMVNEFKLELVEKLF
AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSTTPQSASTITVFQ
PTQMQEPPITTNTTTATTDELKTVTKDGMEDIKILIAFPSPPHVPKETTCATTSPYSDTG
SRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELSPKILALQNAQRKRKIE
HDGSLFQAVGIGTLLQQPDDRATTTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLL
GQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
NT seq 2472 nt   +upstreamnt  +downstreamnt
atggagggcgccggcggcgcgaacgacaagaaaaagataagttctgaacgtcgaaaagag
aagtctagagatgcagccagatctcgacgaagtaaagagtctgaagttttttatgagctt
gctcatcagttgccacttccccataatgtgagctcacatcttgataaggcttctgttatg
aggcttaccatcagctatttgcgtgtgaggaaacttctggatgctggtgatttggatatt
gaagatgaaatgaaggcacagatgaattgcttttatttgaaagccttggacggttttgtt
atggttctcacagatgatggtgacatgatttacatttcggataatgtgaacaaatacatg
gggttaactcagtttgaactaaccggacacagtgtgtttgattttactcatccgtgtgac
catgaggaaatgagagaaatgcttacacacagaaatggccttgtgaaaaagggtaaagag
caaaatacacagcggagcttttttctcagaatgaagtgtaccctaactagccggggaaga
actatgaacataaagtctgcaacatggaaagtacttcactgcacaggccatattcatgta
tatgataccaatagtaaccaatctcaatgtgggtataagaaaccacctatgacatgcttg
gtgctgatttgtgaacccattcctcatccgtcaaatattgaaattcctttagacagcaag
acttttctcagtcgtcacagtctggatatgaagttttcttattgtgatgaaagaattaca
gaattgatgggatatgagccagaagaacttttgggccgctcaatttatgaatattatcat
gctttggactctgatcatctgaccaaaactcatcatgatatgtttactaaaggacaagtc
accacaggacagtacaggatgcttgccaaaagaggtggctatgtctgggttgaaactcaa
gcaactgtcatatataacactaagaactctcaaccacagtgcattgtatgtgtaaattat
gttgtgagtggtattattcagcacgacttgattttctcccttcaacaaacagaatgtgtc
ctcaaaccagttgaatcttcagacatgaaaatgactcagctattcaccaaagttgaatca
gaagatacaagtagtctctttgataaacttaagaaggaacctgatgctttaactttgctg
gccccagctgctggagacacaatcatatctttagattttggcagcaatgacacagaaact
gatgaacaacaacttgaggaagttccattgtataatgatgtaatgctcccctcatccaat
gagaaattacagaatataaatttggcaatgtctccattacctgcctctgaaactccaaag
ccacttagaagtagtgctgaccctgcactcaatcaggaagttgcattaaagttagaacca
aatccagagtcactggaactttctttcaccatgccccagattcaagatcagccagctagt
ccttctgatggaagcaccagacaaagttcacctgagcctaacagtcccagtgaatattgt
tttgatgtggatagtgatatggtcaatgaattcaagttggaattggtagagaaacttttt
gctgaagacacggaagcaaagaatccattttccactcaggacactgatttagacttggag
atgttagctccttatatcccaatggatgatgacttccagttacgttccttcgaccagttg
tcaccattggaaagcagttctactactcctcaaagtgcgagcacaattacagtattccag
ccgactcaaatgcaggaacctcctataaccaccaacactaccacagccaccactgatgaa
ttaaaaacagtgacaaaagatggtatggaagacattaaaatattgattgcatttccatct
cctccccacgtacctaaagaaactacttgtgccacaacatcaccatatagtgacactgga
agtcggacagcctcaccaaacagagcaggaaaaggagtcatagaacagacagaaaaatct
catccaagaagccctaatgtgttatctgtcgctttgagtcaaagaactactgttcctgag
gaagaactaagtccaaagatactagctttgcagaatgctcagagaaagcgaaaaatagaa
catgatggctcactttttcaagcagtgggaattggaacattattacagcaaccagatgat
cgtgcaactactacatcactttcttggaaacgcgtaaaaggatgcaaatctagtgaacag
aatggaatggagcaaaagacaattattttaataccctctgatttagcatgtagactgctg
gggcaatcaatggatgagagtggattaccacagctgaccagttatgattgtgaagttaat
gctcctatacaaggcagcagaaacctactgcagggtgaagaattactcagagctttggat
caagttaactga

DBGET integrated database retrieval system