KEGG   Delphinapterus leucas (beluga whale): 111173177
Entry
111173177         CDS       T05885                                 

Gene name
SOS2
Definition
(RefSeq) son of sevenless homolog 2 isoform X1
  KO
K03099  son of sevenless
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04062  Chemokine signaling pathway
dle04068  FoxO signaling pathway
dle04072  Phospholipase D signaling pathway
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04540  Gap junction
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04714  Thermogenesis
dle04722  Neurotrophin signaling pathway
dle04810  Regulation of actin cytoskeleton
dle04910  Insulin signaling pathway
dle04912  GnRH signaling pathway
dle04915  Estrogen signaling pathway
dle04917  Prolactin signaling pathway
dle04926  Relaxin signaling pathway
dle04935  Growth hormone synthesis, secretion and action
dle05034  Alcoholism
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111173177 (SOS2)
   04012 ErbB signaling pathway
    111173177 (SOS2)
   04014 Ras signaling pathway
    111173177 (SOS2)
   04630 JAK-STAT signaling pathway
    111173177 (SOS2)
   04068 FoxO signaling pathway
    111173177 (SOS2)
   04072 Phospholipase D signaling pathway
    111173177 (SOS2)
   04151 PI3K-Akt signaling pathway
    111173177 (SOS2)
   04150 mTOR signaling pathway
    111173177 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111173177 (SOS2)
   04540 Gap junction
    111173177 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111173177 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111173177 (SOS2)
   04660 T cell receptor signaling pathway
    111173177 (SOS2)
   04662 B cell receptor signaling pathway
    111173177 (SOS2)
   04664 Fc epsilon RI signaling pathway
    111173177 (SOS2)
   04062 Chemokine signaling pathway
    111173177 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111173177 (SOS2)
   04912 GnRH signaling pathway
    111173177 (SOS2)
   04915 Estrogen signaling pathway
    111173177 (SOS2)
   04917 Prolactin signaling pathway
    111173177 (SOS2)
   04926 Relaxin signaling pathway
    111173177 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    111173177 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111173177 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    111173177 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111173177 (SOS2)
   05206 MicroRNAs in cancer
    111173177 (SOS2)
   05205 Proteoglycans in cancer
    111173177 (SOS2)
   05231 Choline metabolism in cancer
    111173177 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111173177 (SOS2)
   05225 Hepatocellular carcinoma
    111173177 (SOS2)
   05226 Gastric cancer
    111173177 (SOS2)
   05214 Glioma
    111173177 (SOS2)
   05221 Acute myeloid leukemia
    111173177 (SOS2)
   05220 Chronic myeloid leukemia
    111173177 (SOS2)
   05211 Renal cell carcinoma
    111173177 (SOS2)
   05215 Prostate cancer
    111173177 (SOS2)
   05213 Endometrial cancer
    111173177 (SOS2)
   05224 Breast cancer
    111173177 (SOS2)
   05223 Non-small cell lung cancer
    111173177 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    111173177 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111173177 (SOS2)
   05160 Hepatitis C
    111173177 (SOS2)
   05163 Human cytomegalovirus infection
    111173177 (SOS2)
   05165 Human papillomavirus infection
    111173177 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111173177 (SOS2)
   01522 Endocrine resistance
    111173177 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dle04990]
    111173177 (SOS2)
Domain-containing proteins not elsewhere classified [BR:dle04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   111173177 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_19 PH_13
Other DBs
NCBI-GeneID: 111173177
NCBI-ProteinID: XP_022426331
UniProt: A0A2Y9MZN4
LinkDB
Position
Unknown
AA seq 1332 aa
MQQAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPNLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRDLFKPSDI
EKIFSNILDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEHEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPG
YSSAEYRLKEKFVMRKIQICDKEDTCECKHAFELVSKDENSIIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
VEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILD
EAVELSQDHFKKYLLKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGNASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKISFSRIAETELESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDHDASNSKGTMKSDDDPPAIPPRQPPPPKVKPRVPAPSGAFDGPL
HSPPPPPPRGPLPDTPPPVPLRPPEHFINCPFTLQPPPLGHLHRDPDWFRDVSTCPNSPN
TPPSTPSPRVPRRCYVLSSSQNNLAHPQAPPVPPRQNSSPHLPKLPPKTYKRELSQPPLY
RLPLLENAETPQ
NT seq 3999 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccgtacgagttcttcagcgaagagaacagtccgaaatggcgg
ggactgttggtctcggccctgcggaaggttcaggagcaagtacatcccaatctctcagct
aatgaagagtctctctattatattgaagagctgatttttcagctgcttaataaattatgc
atggcccaaccaaggactgttcaagatgtggaggaacgagttcaaaagacctttcctcat
ccaattgataaatgggctattgctgatgcacagtctgccatagagaaacgaaaacgaaga
aatcctctcttactgcctgtggacaaaatccatccttcattgaaggaagttttagggtac
aaagtggactaccatgtgtccctatatattgtggctgtactagagtatatctcagctgat
attttgaaattggctggtaattatgtttttaatatccgacattatgaaatatcccaacag
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggcttggtttctctttgtgaagatgaacctagttcttcaggtgaattaaactactat
gaccttgtcagaactgaaattgcagaagaaagacagtatctacgggaactaaatatgatc
ataaaagtgtttcgagaagcttttctttctgacagagacctgtttaaaccttctgatatt
gaaaagattttcagtaacattttagatatacatgaattgaccgtgaaacttttaggttta
attgaagacacagttgaaatgactgatgaaagcagccctcatcccttagctggaagctgt
tttgaagatttggcagaggaacaagcatttgatccttatgaaacattatcacaggatatt
ctttcaccaaaatttaatgaacatttcagtaagttgatggccagacctgcagtggctcta
cactttcagtccattgctgatggttttaaagaggcagttcgttatgtccttccacgcctt
atgctggtgccagtatatcattgttggcactattttgaattattaaagcaattgaaagca
tgtagtgaagagcatgaagacagagaatgtttgaaccaagctattactgctcttatgaat
ctccaaggtagcatggaccgaatttacaagcagtattcacctagacgccgacctggggat
cctgtttgccctttttataatcgtcaattaagaagcaagcacctggctattaaaaaaatg
aatgaaattcagaaaaacatagatggatgggaaggcaaagatattggacagtgttgtaat
gaatttattatggaaggcccattgacaagaattggtgctaaacacgaacggcatattttt
ctctttgatggcttaatgattagctgcaaacccaatcatagccagtcacgccttccagga
tacagtagtgcagaatacagattaaaagaaaaatttgtcatgaggaaaatacaaatatgt
gataaagaagatacttgtgagtgcaagcatgcttttgaattagtatccaaagatgaaaac
agcataatatttgctgctaagtctgctgaagagaaaaataattggatggcagcacttatt
tctcttcattatcgtagtactctagatcgaatgctagattcagtattactgaaggaagaa
aatgaacaaccacttagattaccgagtcctgaagtgtatcgttttgtggtaaaagactct
gaggaaaacattgtttttgaagacaacttgcaaagtagaagtggaatccccattattaaa
ggaggaactgtggtgaaattaattgaaaggttaacatatcacatgtatgcagatcccaat
tttgttcgcacttttcttactacgtatcgttcattttgtaaaccacaggaattgctaagc
ttactgattgaacgatttgaaattccagagccagaacctactgaagcagataaattggca
gtagagaaaggcgagcagccaatcagtgcagaccttaaaaggtttcgcaaggaatacgtc
caaccagtacaacttaggatcttgaatgtgtttcggcactgggttgaacaccatttttat
gactttgaaagagacttggagttgcttgaaagactagaatccttcatttcaagtgtaaga
gggaaagctatgaagaaatgggtagagtcaattgctaagatcatcaagaggaagaaacaa
gctcaggcaaatggaataagccataatattacctttgaaagtccacctccaccaattgaa
tggcatatcagcagaccaggacagtttgaaacgtttgatctcatgacacttcatccaata
gaaattgcacgtcagctgacacttttggaatctgatctctacaggaaagttcaaccttct
gaacttgtagggagtgtatggaccaaagaagataaagaaataaattctccaaatttatta
aaaatgattcgccacaccacaaatctcactctctggtttgaaaagtgcattgtggaagca
gaaaattttgaggaacgggtggcagtactaagtagaattatagaaattctgcaagttttt
caagatttgaataatttcaatggtgtattagagatcgtcagtgcagtaaattcagtatca
gtctatagactagatcatacctttgaggcattgcaggaaagaaaaaggaaaattttggat
gaagctgtggaattaagtcaagatcattttaaaaaatatctgttgaaacttaagtcaatc
aatccaccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaagaa
gggaataatgattttttaaaaaagaaagggaaagatttaatcaatttcagtaagaggagg
aaagtagctgaaattactggagaaattcagcaatatcagaatcaaccttactgtttacgg
atagaaccagaaatgaggaggttctttgaaaaccttaaccccatgggaaatgcttctgaa
aaagagtttacagattatctgttcaacaagtcactagaaattgaaccccggaactgcaaa
cagccacctcgatttcctaggaaatcaactttctctttaaaatctcctggaataaggcct
aatacaggccgacatggctctacctcaggtactttacgaggtcatccaacaccattagaa
agagaaccatgtaaaataagctttagtcggattgctgaaacagagcttgaatcaacagtg
tcagcaccaacctctccaaatacaccatctactccaccagtatctgcttcttcagacctt
agtgtgtttttagatgtggatctcaacagttcctgtggaagcaatagcatctttgctcca
gtcctcttgcctcattcaaagtctttctttagttcgtgtggtagtttacataaactaagt
gaagagccactgattcctcctccacttcctcctcgaaaaaaatttgatcatgatgcttca
aattccaagggaactatgaaatctgatgatgacccccctgctattccaccaagacagcct
cctcctccaaaggtaaaacccagagttcctgctccttctggtgcatttgacgggcctctg
catagtccaccgccgccgccgccgagaggtcctcttcccgatacccctccaccagttccc
cttcggcctccagaacactttataaactgtccgtttactcttcagccacctccactggga
catcttcacagagatccagactggttcagagacgttagtacgtgtccaaattctccaaac
actcctcctagcacaccctctccaagggtaccacgtcgatgctacgtgctcagttctagt
cagaataatcttgctcatcctcaagctccccctgttccaccaaggcagaattcaagccct
cacctaccaaaactgccaccaaagacttacaaacgggagctttcgcaacccccattgtat
agactgcctttgctagaaaatgcagaaactcctcaatga

KEGG   Delphinapterus leucas (beluga whale): 111174855
Entry
111174855         CDS       T05885                                 

Gene name
SOS1
Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04062  Chemokine signaling pathway
dle04068  FoxO signaling pathway
dle04072  Phospholipase D signaling pathway
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04540  Gap junction
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04714  Thermogenesis
dle04722  Neurotrophin signaling pathway
dle04810  Regulation of actin cytoskeleton
dle04910  Insulin signaling pathway
dle04912  GnRH signaling pathway
dle04915  Estrogen signaling pathway
dle04917  Prolactin signaling pathway
dle04926  Relaxin signaling pathway
dle04935  Growth hormone synthesis, secretion and action
dle05034  Alcoholism
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111174855 (SOS1)
   04012 ErbB signaling pathway
    111174855 (SOS1)
   04014 Ras signaling pathway
    111174855 (SOS1)
   04630 JAK-STAT signaling pathway
    111174855 (SOS1)
   04068 FoxO signaling pathway
    111174855 (SOS1)
   04072 Phospholipase D signaling pathway
    111174855 (SOS1)
   04151 PI3K-Akt signaling pathway
    111174855 (SOS1)
   04150 mTOR signaling pathway
    111174855 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111174855 (SOS1)
   04540 Gap junction
    111174855 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111174855 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111174855 (SOS1)
   04660 T cell receptor signaling pathway
    111174855 (SOS1)
   04662 B cell receptor signaling pathway
    111174855 (SOS1)
   04664 Fc epsilon RI signaling pathway
    111174855 (SOS1)
   04062 Chemokine signaling pathway
    111174855 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111174855 (SOS1)
   04912 GnRH signaling pathway
    111174855 (SOS1)
   04915 Estrogen signaling pathway
    111174855 (SOS1)
   04917 Prolactin signaling pathway
    111174855 (SOS1)
   04926 Relaxin signaling pathway
    111174855 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    111174855 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111174855 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    111174855 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111174855 (SOS1)
   05206 MicroRNAs in cancer
    111174855 (SOS1)
   05205 Proteoglycans in cancer
    111174855 (SOS1)
   05231 Choline metabolism in cancer
    111174855 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111174855 (SOS1)
   05225 Hepatocellular carcinoma
    111174855 (SOS1)
   05226 Gastric cancer
    111174855 (SOS1)
   05214 Glioma
    111174855 (SOS1)
   05221 Acute myeloid leukemia
    111174855 (SOS1)
   05220 Chronic myeloid leukemia
    111174855 (SOS1)
   05211 Renal cell carcinoma
    111174855 (SOS1)
   05215 Prostate cancer
    111174855 (SOS1)
   05213 Endometrial cancer
    111174855 (SOS1)
   05224 Breast cancer
    111174855 (SOS1)
   05223 Non-small cell lung cancer
    111174855 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    111174855 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111174855 (SOS1)
   05160 Hepatitis C
    111174855 (SOS1)
   05163 Human cytomegalovirus infection
    111174855 (SOS1)
   05165 Human papillomavirus infection
    111174855 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111174855 (SOS1)
   01522 Endocrine resistance
    111174855 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dle04990]
    111174855 (SOS1)
Domain-containing proteins not elsewhere classified [BR:dle04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   111174855 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 111174855
NCBI-ProteinID: XP_022429725
UniProt: A0A2Y9N647
LinkDB
Position
Unknown
AA seq 1333 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESSDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENVQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVTLPHGPRSASVSSISL
TKSTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSVSD
RTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHSNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccgtacgagtttttcagcgaggagaacgcgcccaagtggcgg
gggctgctggtgcctgcgctgaaaaaggttcaggggcaagttcatcctactcttgagtct
agtgatgatgctcttcagtatgttgaagaattaattttgcagttattaaatatgctatgc
caagctcagccgcgaagtgcttcagatgtagaggaacgtgttcaaaaaagtttccctcat
ccaattgataagtgggcaatagctgatgcccagtcggctattgaaaagaggaagcgaaga
aaccctttatctctcccagtagaaaaaattcatcctttgttaaaggaggtcctaggttat
aaaattgaccaccaggtttctgtttacatagtagcagtattagaatacatttctgcagac
attttaaagctggtggggaattatgtgcgaaatatacggcattatgaaattacaaaacaa
gatattaaagtggcaatgtgtgctgataaggtattgatggatatgtttcatcaagatgta
gaagatataaatatattatctttaactgatgaagagccttccacctcaggagagcaaact
tattatgatttggtaaaagcatttatggcagaaattcgacaatacataagggaacttaat
ttaattataaaagtttttagagagccctttgtctccaattcaaaattgttttcagctaat
gatgtagaaaatatatttagtcgtatagtggatatacatgaacttagtgtaaagttactg
ggccatatagaagatactgtagaaatgacagatgaaggcagtccccatccattagtagga
agttgctttgaagacttagcagaggaactggcatttgatccatatgaatcatatgctcga
gatattttacgacctggttttcatgatcgtttccttagtcagttatcaaagcctggagcg
gcactctatttgcagtcaataggcgaaggtttcaaagaagctgttcaatatgttttaccc
aggctacttctagcccctgtttaccactgtctacattactttgaacttctgaagcagtta
gaagaaaagagtgaagatcaagaagacaaggaatgtttgaaacaagcaataacagctttg
cttaatgttcagagtggtatggaaaaaatatgctctaaaagtcttgcaaaacgaagactg
agtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcagaagaatattgatggttgggagggaaaagacattggacagtgt
tgcaatgagtttataatggaaggaactcttacacgtgtaggagccaaacatgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcagccaagactt
cctggtgctagcaatgcagagtatcgtcttaaagaaaagttttttatgagaaaggtacaa
attaatgacaaagatgacaccaatgagtacaagcatgcttttgagataattttaaaagat
gaaaatagcgtcatattttctgccaagtcagctgaagagaaaaacaattggatggcagca
ttgatatctttacagtaccggagtacactggaaaggatgcttgatgtgacaatgctacag
gaagaaaaggaggagcagatgaggctccctagtgctgatgtttatagatttgcagagcct
gactctgaagaaaatatcatatttgaagaaaacgtgcagcccaaagctggaattccaatt
atcaaagcaggaactgttattaaacttatagagaggctcacataccatatgtacgcagat
cccaattttgttcggacatttcttacaacatatagatccttttgtaaacctcaagaacta
ctgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
atagctatagagaatggagatcagcccttgagtgcagaactaaaaaggtttagaaaagaa
tatatacagcctgtacaactgcgagtattaaatgtatgtcggcactgggtagagcaccac
ttctacgattttgaaagagatgcagatcttttgcagcgaatggaggaatttattggaaca
gtaagaggtaaagcaatgaaaaagtgggttgaatccatcactaaaataatccaaaggaaa
aaaattgcaagagacaatggaccaggtcataatattacatttcagagttcaccccctaca
gttgagtggcatataagcagacctgggcacatagagacttttgacctgctcaccttacac
ccaatagaaattgctcgacagctcactttacttgaatcagatctatatcgagctgtacag
ccatcagaattagttggaagtgtgtggacaaaggaagacaaagaaattaattctcctaat
cttctgaaaatgatccggcataccactaatctcactctgtggtttgagaaatgtattgta
gaaactgaaaacttagaagaaagagtagctgtggtgagtcgaataattgagattctgcaa
gtctttcaagagctgaacaacttcaatggtgtccttgaggttgtcagtgctatgaactca
tcacctgtatacagactagaccacacgtttgagcaaataccaagtcgccaaaagaaaatt
ttagaagaagctcatgaactaagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggaatttatctaactaatatcttgaaaaca
gaagaaggcaaccctgaggtcctaaaaaggcatggaaaagagcttataaactttagcaaa
aggaggaaagtagcagaaataacaggcgagatccagcagtaccaaaatcagccttattgt
ttacgagtagaatcagatatcaaaaggttctttgaaaacttgaatccaatgggaaatagt
atggaaaaagaatttacagattatcttttcaacaaatccctagaaatagaaccacgaaac
cctaagcctctcccaagatttccaaaaaaatatagctatcccctaaaatctcctggtgtt
cgtccatcaaacccaagaccaggtactatgagacatcccacacctctgcagcaagagcca
aggaaaattagttatagtaggatccctgaaagtgaaacagaaagtacagcatctgcacca
aattctccaagaacaccgttaacacctcctcctgcttctggtgcttctagtaccacagat
gtttgcagcgtatttgattctgatcattcaagcccttttcactcaagcagcgataccgtc
tttatccaagttacactgccccatggcccaagatctgcttcagtatcatctataagttta
accaagagcactgatgaagtgcctgtcccccctcctgttcctccacgaagacgaccagaa
tctgccccagcggaatcttcgccatctaagatcatgtctaagcatttggacagcccccca
gcaattcctcctaggcaacccacatcaaaagcctattcaccacgatattcagtatcagac
cggacctctatatcagatcctcctgaaagccctcccttattacctccacgagaacccgtg
aggacacctgatgttttctcaagctcaccactacatctccaacctccccctttgggcaaa
aaaagtgaccatagtaatgccttcttcccaaacagcccttccccctttacaccacctcct
cctcaaacaccttctcctcacggcacaagaaggcatctgccatcaccaccattgacacaa
gaagtggaccttcattccattgctgggccgcctgttcctccacgacaaagcacttctcaa
catatccctaaactccctccaaaaacttacaaaagggagcatacacacccatccatgcac
agagatggaccaccactgttggagaatgctcattcttcctga

DBGET integrated database retrieval system