Delphinapterus leucas (beluga whale): 111173182 Help Entry 111173182         CDS       T05885                                  Symbol ARF6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04014   Ras signaling pathway dle04072   Phospholipase D signaling pathway dle04144   Endocytosis dle04666   Fc gamma R-mediated phagocytosis dle05132   Salmonella infection dle05135   Yersinia infection Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     111173182 (ARF6)    04072 Phospholipase D signaling pathway     111173182 (ARF6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111173182 (ARF6)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     111173182 (ARF6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111173182 (ARF6)    05135 Yersinia infection     111173182 (ARF6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dle04131]     111173182 (ARF6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dle04147]     111173182 (ARF6)    04031 GTP-binding proteins [BR:dle04031]     111173182 (ARF6) Membrane trafficking [BR:dle04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     111173182 (ARF6)   Arf GTPases and associated proteins    Arf GTPases     111173182 (ARF6) Exosome [BR:dle04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111173182 (ARF6)   Exosomal proteins of colorectal cancer cells    111173182 (ARF6) GTP-binding proteins [BR:dle04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     111173182 (ARF6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  111173182 NCBI-ProteinID:  XP_022426335 UniProt:  A0A2Y9MWV5 LinkDB All DBs Position Unknown AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaggtgctatctaagatcttcggaaacaaggaaatgcggatcctcatgttgggc ctggacgcagccggcaagacaaccatcctgtacaagttgaagctgggccagtcggtgacc accatccctaccgtgggtttcaacgtggagaccgtgacttacaaaaacgtcaagttcaac gtgtgggatgtgggcggccaggacaagatccggccgctctggcggcattactacaccggg acccagggtctgatcttcgtagtggactgcgccgaccgcgaccgcatcgacgaggcccgc caggagctgcaccgcattatcaatgaccgggagatgagggacgccataatcctcatcttc gccaacaagcaggacctgcccgatgccatgaaaccccacgagatccaggagaaactgggc ctgacccggattcgggacaggaactggtatgtgcagccctcctgtgccacctcgggggac ggactctatgaggggctcacatggttaacctctaactacaaatcctaa

DBGET integrated database retrieval system