KEGG   Delphinapterus leucas (beluga whale): 111173225
Entry
111173225         CDS       T05885                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04064  NF-kappa B signaling pathway
dle04210  Apoptosis
dle04380  Osteoclast differentiation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04625  C-type lectin receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04668  TNF signaling pathway
dle04722  Neurotrophin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04926  Relaxin signaling pathway
dle04931  Insulin resistance
dle05132  Salmonella infection
dle05134  Legionellosis
dle05135  Yersinia infection
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05215  Prostate cancer
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111173225 (NFKBIA)
   04668 TNF signaling pathway
    111173225 (NFKBIA)
   04024 cAMP signaling pathway
    111173225 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111173225 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111173225 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    111173225 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    111173225 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    111173225 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    111173225 (NFKBIA)
   04660 T cell receptor signaling pathway
    111173225 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    111173225 (NFKBIA)
   04659 Th17 cell differentiation
    111173225 (NFKBIA)
   04657 IL-17 signaling pathway
    111173225 (NFKBIA)
   04662 B cell receptor signaling pathway
    111173225 (NFKBIA)
   04062 Chemokine signaling pathway
    111173225 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111173225 (NFKBIA)
   04926 Relaxin signaling pathway
    111173225 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111173225 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111173225 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111173225 (NFKBIA)
   05203 Viral carcinogenesis
    111173225 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111173225 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    111173225 (NFKBIA)
   05215 Prostate cancer
    111173225 (NFKBIA)
   05222 Small cell lung cancer
    111173225 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111173225 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111173225 (NFKBIA)
   05135 Yersinia infection
    111173225 (NFKBIA)
   05134 Legionellosis
    111173225 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111173225 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    111173225 (NFKBIA)
   05161 Hepatitis B
    111173225 (NFKBIA)
   05160 Hepatitis C
    111173225 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    111173225 (NFKBIA)
   05164 Influenza A
    111173225 (NFKBIA)
   05162 Measles
    111173225 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    111173225 (NFKBIA)
   05163 Human cytomegalovirus infection
    111173225 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111173225 (NFKBIA)
   05169 Epstein-Barr virus infection
    111173225 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111173225 (NFKBIA)
   05140 Leishmaniasis
    111173225 (NFKBIA)
   05142 Chagas disease
    111173225 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111173225 (NFKBIA)
   04131 Membrane trafficking [BR:dle04131]
    111173225 (NFKBIA)
Transcription factors [BR:dle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    111173225 (NFKBIA)
Membrane trafficking [BR:dle04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    111173225 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 111173225
NCBI-ProteinID: XP_022426423
UniProt: A0A2Y9NB16
LinkDB
Position
Unknown
AA seq 314 aa
MFQPAEPGQEWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP
RGAEPWKQQVTEDGDSFLHLAIIHEEKVLTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSILQATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL
PYDDCVLGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgttccagcccgcggagcccggccaggagtgggccatggagggcccccgggacgcactc
aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag
gagtacgagcagatggtgaaagagctaagggagatccgcctcgagcctcaggaggcgccg
cgcggcgccgagccttggaagcagcaggtcactgaggacggagactcgttcctgcacttg
gccatcatccatgaagagaaggtgctgaccatggaagtggtccgccaagtgaagggagac
ctggcgttcctcaacttccagaacaacctgcagcagactcctctccacttggcggtgatc
accaaccagccagagatcgctgaggcacttctggaagctggctgtgatcctgagctccga
gactttcgaggaaatacccccttacaccttgcctgtgagcaaggctgcctggccagtgtg
ggagtcctgactcagccccgcgggacccagcacctccactccatcctacaagccaccaac
tacaatggtcacacgtgtctgcatttggcctctattcatggctacctgggcatcgtggag
ctgttggtgtccttgggtgctgatgtcaacgcacaggagccctgcaatggccgaactgcc
ctccatcttgcggttgacctgcagaatcccgacctggtgtcgctcttgttgaagtgtggg
gccgacgtcaacagggtcacctaccagggctactccccgtaccagctcacctggggccgc
ccaagcacccggatacagcagcagctgggccagctgaccctagagaaccttcagatgctg
cccgagagcgaggatgaggagagctatgacacggagtcagagttcacagaggatgagctg
ccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system