KEGG   Delphinapterus leucas (beluga whale): 111173425
Entry
111173425         CDS       T05885                                 

Gene name
TLR3
Definition
(RefSeq) toll-like receptor 3
  KO
K05401  toll-like receptor 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04217  Necroptosis
dle04620  Toll-like receptor signaling pathway
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111173425 (TLR3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111173425 (TLR3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    111173425 (TLR3)
   05160 Hepatitis C
    111173425 (TLR3)
   05171 Coronavirus disease - COVID-19
    111173425 (TLR3)
   05164 Influenza A
    111173425 (TLR3)
   05168 Herpes simplex virus 1 infection
    111173425 (TLR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111173425 (TLR3)
   05165 Human papillomavirus infection
    111173425 (TLR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:dle04054]
    111173425 (TLR3)
   04090 CD molecules [BR:dle04090]
    111173425 (TLR3)
Pattern recognition receptors [BR:dle04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   111173425 (TLR3)
CD molecules [BR:dle04090]
 Proteins
  111173425 (TLR3)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 Tlr3_TMD TIR TIR_2 LRR_9 LRRNT
Other DBs
NCBI-GeneID: 111173425
NCBI-ProteinID: XP_022426731
UniProt: A0A2Y9N0N8
LinkDB
Position
Unknown
AA seq 905 aa
MSRDLLYRIYSFWGLLPFWILCTSSTNKCTVRHEIADCSHLKLTQIPDDLPTNITVLNVT
HNQLRRLPPANFTRYSQLTILDGGFNSISKLEPELCQSLPLLEILNLQHNELSQLSDKTF
IFCMNLTELHLMSNSIQKIQSNPFKSLKNLIKLDLAHNGLSSTKLGTQLQLENLQELLLS
NNKISALRREELDFLGNSSLKRLELSSNQIKEFSPGCFHAIGKLFGFSLNNAKLSPSLIE
ELCLELSNTSIQNLSLSNNQLYTTSNTTFVGLKQTNLTMLDLSHNSLSVIGNDSFAWLPH
LEYLFLEYNNIQHLSSRSFYGLSNVRYLNLRRSFTKQSISLASLPKIDDFSFQWLKFLEY
LNMEDNTFPGIKSNTFTGLTRLRCLSLSNSFSSLRTLTNETFLSLAGSPLLILNLTKNKI
SKIESGAFSWLGHLNVLDLGLNEIGQELTGQEWRGLENIVEIYLSYNKYLELTSNSFALV
PSLQRLMLRRVALKNVNSSPSPFHPLPNLTILDLSNNNIANINDELLKGLEKLEILDLQH
NNLARLWKHANPGGPIHFLKGLSHLHILNLESNGFDEVPAEVFKDLRELKSIDLGLNNLN
ILSPSVFDNQVSLKSLSLQKNLITSVEKNVFGPAFKNLSNLDMSFNPFDCTCESIAWFVT
WINNTHTNISELSSRYLCNTPPQYHGFPVMLFDISPCKDSAPFELLFMINTSILLIFILL
VLLIHFEGWKISFYWNVSVHRVLGFKEIDRQPEQFEYAAYIIHAYKDRDWVWEHFSPMEE
EDHTLRFCLEERDFEAGVLELEAIVNSIRRSRKIIFVITQNLLKDPLCKRFKVHHAVQQA
IEQSLDSIILIFLEDIPDYKLNHALCLRRGMFKSHCILNWPVQKERLNAFHHKLQVALGS
RNSVH
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgagcagggatttgctttatcgtatctactccttttggggactgttgcccttctggata
ctgtgtacatcttctaccaacaaatgtactgttagacatgaaatagctgactgcagtcat
ctgaagttgactcaaatacctgatgacctcccaacaaacataacagtgttgaatgttacc
cataatcaactcagaagattaccacctgccaattttacaagatacagccaacttactatc
ttggatggaggatttaactccatctcaaagctggagccagaactgtgccaaagtctccct
ttgttggaaattttgaacctccaacacaatgagctatctcagctttctgataaaaccttt
atcttctgcatgaatttgactgaactccatctaatgtccaactcaatccagaaaattcaa
agtaatccctttaaaagcctgaagaatttaatcaaattagacctagctcataatggttta
tcatctactaaattaggaactcagctgcaactggaaaatctccaagagcttctactatca
aataataaaatttctgcactaagacgtgaagaacttgatttccttggcaactcttcttta
aaaagattagagttgtcatcaaatcaaataaaagagttctctccagggtgttttcatgca
attggaaaattatttggcttctctctgaacaatgccaaactgagccccagtctcatagaa
gagctctgcttggaattatcaaacacaagcattcagaatctgtccctgagcaacaaccag
ctgtacacaaccagcaacacgacttttgttgggctgaagcagacaaatctcacaatgctc
gatctttcccataacagcttaagtgtgattggtaatgattcctttgcttggcttccacat
ctagaatatctctttttggagtataataatatacaacatctgtcttctcgctctttttat
gggctttccaatgtgagatacctgaatttgagacgatcttttactaaacaaagcatttcc
ctggcttcacttcccaagattgatgatttttcctttcagtggctaaaatttttggagtat
ctcaatatggaagataacacctttccaggcataaaaagcaatactttcacgggattgaca
aggctgagatgtttaagtctatccaactccttctcaagtttgcgaactttaacaaatgaa
acgtttttatcacttgctggttctcctctgctcatactcaacctaaccaaaaataaaatc
tcaaaaatagagagtggtgctttttcttggttgggccacctaaatgtacttgaccttggc
cttaatgaaattgggcaagaactcacaggccaggaatggagaggtctagaaaatattgtt
gaaatctacctttcctacaacaaatacctagagctgactagcaactcttttgccttggtt
ccaagccttcaacgactgatgctccgaagggtggcccttaaaaatgtgaatagctcccct
tcaccttttcaccctcttcctaacctgaccattctggatctaagcaacaacaacatagcc
aacataaatgatgaactgttgaagggtcttgagaaactagaaattctggatttgcagcat
aacaacttagctcgcctctggaagcatgcaaaccctggtggtcctattcattttctgaag
ggtctttctcacctccacatccttaacttagagtctaatggctttgatgaggtcccagca
gaagtcttcaaggacttacgtgaattgaagagcatcgatttaggattgaataatttaaat
atcctttcgccatctgtctttgataatcaagtgtcgctaaagtcattaagccttcagaag
aatctcataacatctgttgaaaagaatgtttttgggccagcattcaagaacctgagtaat
ttagatatgagctttaatccattcgattgtacatgtgaaagcattgcctggtttgttact
tggattaataatacccataccaacatctctgaactatcaagccgttacctctgcaacact
ccacctcaatatcatggtttcccagtgatgctttttgatatatcaccctgcaaagacagt
gccccatttgaactccttttcatgataaataccagtatcctattgatttttatccttctt
gtactcctcatccattttgaaggctggaagatatctttttattggaatgtttcagtgcat
cgagttcttggtttcaaagaaatagacagacagccagaacagtttgaatatgcggcatat
ataattcatgcctataaggatagggattgggtctgggaacacttctccccaatggaagaa
gaagatcatacactcagattttgtctggaagaaagggattttgaggcaggtgtccttgaa
cttgaagcaattgttaatagcatcagaaggagcagaaaaattatttttgttataacacag
aatctactgaaagatccattatgcaaaagattcaaggtgcaccacgcagttcagcaagct
attgaacaaagtctggattccattatattaatctttcttgaggatattccggattataaa
ctgaatcatgcgctctgtttgcgaagagggatgtttaaatctcactgcatcttgaactgg
ccggttcagaaagaacggttaaatgcctttcatcataaattgcaagtagcacttggttcc
agaaattcagtacattaa

DBGET integrated database retrieval system