KEGG   Delphinapterus leucas (beluga whale): 111173487
Entry
111173487         CDS       T05885                                 

Gene name
NRG1
Definition
(RefSeq) pro-neuregulin-1, membrane-bound isoform isoform X1
  KO
K05455  neuregulin 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04012  ErbB signaling pathway
dle05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111173487 (NRG1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111173487 (NRG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111173487 (NRG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111173487 (NRG1)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111173487 (NRG1)
Cytokines and growth factors [BR:dle04052]
 Growth factors
  Growth factors (RTK binding)
   111173487 (NRG1)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111173487 (NRG1)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 V-set EGF EGF_2 BiPBP_C DUF973 Cyt_b-c1_8
Other DBs
NCBI-GeneID: 111173487
NCBI-ProteinID: XP_022426867
UniProt: A0A2Y9N632
LinkDB
Position
Unknown
AA seq 852 aa
MRWRRAPRRSERTGPRAPRPGPAARSPPPPPLLLLLLLWTAALAPGAAAGDEAAPAGASV
CYASPPSVGSVQELAQRAAVVIEGKVHAPRRQQGALDRKAAAAAAAGEAGAWGGERQPSA
AGPGALPAANRTVHPWPTGPARSAAEPGDEAPYLVKVHQVWAVKAGGLKKDSLLTVRLGA
WGHPAFPSCGRLKEDSRYIFFMEPDANSSGRAPAAFRASFPPLETGRNLKKEVSRVLCKR
CALPPRLKEMKSQESAAGSKLVLRCETSSEYSSLKFRWFKNGNELNRKNKPQNIKIQKRP
GKSELRINKASLADSGEYMCKVISKLGNDSASANITIVDANEIITGMPASTETAYVSSES
PIRISVSTEGANTSSSTSTSTTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKC
PNEFTGDRCQNYVMASFYKHLGIEFMEAEELYQKRVLTITGICIALLVVGIMCVVAYCKT
KKQRKKLHDRLRQSLRSERNNMVNIANGPHHPNPPPENVQLVNQYVSKNVISSEHIVERE
AETSFSTSHYTSTAHHSTTVTQTPSHSWSNGHTESIISESHSVIVMSSVENSRHSSPTGG
PRGRLNGLGGPRECNSFLRHARETPDSYRDSPHSERYVSAMTTPARMSPVDFHTPSSPKS
PPSEMSPPVSSTTVSMPSMAVSPFVEEERPLLLVTPPWLRERDVQHVQQLNSFHCNPAHE
SRSPPPSPLRIVEDEEYETTQEYELTQESVKKLTNSRRAKRTKPNGHIAHRLEMDSNTSA
ESSNSESETEDERVGEDTPFLGIQNPLAANVEAAPAFHLADSRTNPAGRFSPQEELQARL
SGVIANQDPIAV
NT seq 2559 nt   +upstreamnt  +downstreamnt
atgagatggcgacgcgccccgcgccgctccgagaggaccggaccccgggccccgcgcccc
ggccctgccgcccgctcgccgccgccgccgccgctgctgctgctgctgctgctgtggacc
gcggccctggcgccgggggcggccgccggcgacgaggcggctcccgcgggggcctcggtg
tgctacgcgtccccgcccagcgtgggctcggtgcaggagctggctcagcgcgccgcggtg
gtgatagagggaaaggtgcacgcgccgcggcggcagcagggggcactcgacaggaaggca
gcggcggcggcggcggcgggcgaggcaggggcgtggggaggcgagcgccagccgtcagcc
gccggcccgggagcgctgcccgccgccaaccggaccgtgcacccgtggcccacgggcccc
gcgcgcagcgccgccgagcccggagacgaggcgccgtatctggtgaaggtgcaccaggtg
tgggcggtgaaagccgggggcttgaagaaggactcactgctcaccgtgcgcctgggcgcc
tggggccaccccgcgttcccctcctgcgggcggctcaaggaggacagcaggtatatcttc
ttcatggagcccgatgccaacagcagcggccgtgcgcctgccgccttccgagcatccttc
ccccctctcgagacgggccggaacctcaagaaggaagtcagccgggtgctgtgcaagcgg
tgcgccttgcctccccgattgaaagagatgaaaagtcaggagtctgcagcaggttcaaaa
ctcgtgcttcggtgcgagaccagttctgaatattcctctctcaaattcagatggttcaag
aatgggaatgaattaaaccgaaagaacaaaccacaaaacatcaagatacaaaaaaggcca
gggaagtcagaacttcgcattaacaaagcatcactggctgattctggagaatatatgtgc
aaagtgatcagcaaattaggaaacgacagtgcttctgccaatatcaccattgtggatgca
aatgagatcatcactggcatgccagcctcaactgagacagcgtatgtgtcttcagagtct
cccattagaatatcagtatcaacagaaggagcaaatacttcttcatccacatctacatct
accactgggacaagccatcttgtcaagtgtgcagagaaggagaaaactttctgtgtgaat
ggaggcgagtgcttcatggtgaaagacctttcaaacccctcaagatacttgtgcaagtgc
ccaaatgagtttactggtgatcgctgccaaaactacgtaatggccagcttctacaagcat
cttgggattgaatttatggaagcggaggagctctaccagaagagagtactcaccatcacc
ggcatctgcattgcgctgcttgtggtcggcatcatgtgtgtggtggcctactgcaaaacc
aagaagcaacggaaaaagcttcatgaccggcttcggcagagtcttcgctctgaacgaaac
aacatggtgaacatagccaacgggccccatcaccccaatccaccccccgagaacgtgcag
ctggtgaatcaatacgtatctaaaaatgtcatctccagcgagcatattgtcgagagagag
gcggagacgtctttttccaccagtcactacacttcgacagctcatcactccactactgtc
acccagactcccagtcacagctggagcaacggacacactgaaagcatcatttcagaaagc
cactctgtcatcgtgatgtcatctgtagaaaacagtaggcacagcagccctactgggggc
ccaagaggacgtcttaatggcttgggaggccctcgcgagtgtaacagcttcctcaggcat
gccagagaaacccctgactcctaccgagattctcctcatagtgaaaggtatgtatcagca
atgaccaccccggctcgtatgtcgcctgtagatttccacacgccaagctcccccaagtcg
cccccttcggaaatgtctccacccgtgtccagcacgacggtgtccatgccctccatggca
gtcagtcccttcgtggaagaagagagacccctgcttcttgtgacgccgccatggctgcgg
gagagggatgtccagcacgttcagcagctcaactccttccactgcaaccctgcgcacgag
agccgcagcccaccccctagccccttgaggatagtggaggatgaagagtatgaaacgacc
caggagtatgaactgactcaagagtcggttaagaaactcaccaacagccggcgggctaaa
agaaccaagcccaatggtcatattgcccacagattggaaatggacagcaacacaagcgct
gagagcagtaactcagagagtgaaacagaggatgaaagagtaggagaagatacacctttc
ctgggcatacagaaccccctggcagccaatgttgaggcagcccctgccttccacctggct
gacagcaggactaacccagcaggccgcttctctccgcaggaagaattgcaggccaggctg
tccggtgtaatcgctaaccaagaccctattgctgtataa

DBGET integrated database retrieval system