KEGG   Delphinapterus leucas (beluga whale): 111173509
Entry
111173509         CDS       T05885                                 

Gene name
EIF4EBP1
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle03013  RNA transport
dle04012  ErbB signaling pathway
dle04066  HIF-1 signaling pathway
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04218  Cellular senescence
dle04910  Insulin signaling pathway
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05168  Herpes simplex virus 1 infection
dle05221  Acute myeloid leukemia
dle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    111173509 (EIF4EBP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111173509 (EIF4EBP1)
   04066 HIF-1 signaling pathway
    111173509 (EIF4EBP1)
   04151 PI3K-Akt signaling pathway
    111173509 (EIF4EBP1)
   04152 AMPK signaling pathway
    111173509 (EIF4EBP1)
   04150 mTOR signaling pathway
    111173509 (EIF4EBP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111173509 (EIF4EBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111173509 (EIF4EBP1)
  09149 Aging
   04211 Longevity regulating pathway
    111173509 (EIF4EBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    111173509 (EIF4EBP1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111173509 (EIF4EBP1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111173509 (EIF4EBP1)
   05163 Human cytomegalovirus infection
    111173509 (EIF4EBP1)
   05165 Human papillomavirus infection
    111173509 (EIF4EBP1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111173509 (EIF4EBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dle03019]
    111173509 (EIF4EBP1)
Messenger RNA biogenesis [BR:dle03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     111173509 (EIF4EBP1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 111173509
NCBI-ProteinID: XP_022426914
UniProt: A0A2Y9MWX2
LinkDB
Position
Unknown
AA seq 118 aa
MSSGSSCSQTPSRAIPATRRVVLSDGVHLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPVGHEPPTEASQDHLSSSPEDKPAGGEESQFEMDI
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtccagcggcagcagctgcagccagaccccaagccgggccatccccgccactcgccgg
gtggtcctcagcgacggcgtgcacctgccgcccggggactacagcaccacccccggcggc
acgctcttcagtaccaccccgggaggtaccaggatcatctacgaccggaagttcctaatg
gagtgtcggaactcacctgtgaccaaaacgcccccgcgggacctgcccaccattcccggg
gtcactagccctgtgggtcatgagccccctacagaagccagccaggaccacctgagcagc
agcccagaggacaagccggcgggcggtgaagagtcacaatttgagatggacatttaa

DBGET integrated database retrieval system