KEGG   Delphinapterus leucas (beluga whale): 111173555
Entry
111173555         CDS       T05885                                 

Gene name
VDAC3
Definition
(RefSeq) voltage-dependent anion-selective channel protein 3
  KO
K15041  voltage-dependent anion channel protein 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04020  Calcium signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04216  Ferroptosis
dle04217  Necroptosis
dle04218  Cellular senescence
dle04621  NOD-like receptor signaling pathway
dle04979  Cholesterol metabolism
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05016  Huntington disease
dle05017  Spinocerebellar ataxia
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05161  Hepatitis B
dle05166  Human T-cell leukemia virus 1 infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    111173555 (VDAC3)
   04022 cGMP-PKG signaling pathway
    111173555 (VDAC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    111173555 (VDAC3)
   04217 Necroptosis
    111173555 (VDAC3)
   04218 Cellular senescence
    111173555 (VDAC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111173555 (VDAC3)
  09154 Digestive system
   04979 Cholesterol metabolism
    111173555 (VDAC3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111173555 (VDAC3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111173555 (VDAC3)
   05012 Parkinson disease
    111173555 (VDAC3)
   05016 Huntington disease
    111173555 (VDAC3)
   05017 Spinocerebellar ataxia
    111173555 (VDAC3)
   05020 Prion disease
    111173555 (VDAC3)
   05022 Pathways of neurodegeneration - multiple diseases
    111173555 (VDAC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111173555 (VDAC3)
   05161 Hepatitis B
    111173555 (VDAC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dle03029]
    111173555 (VDAC3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dle04040]
    111173555 (VDAC3)
Mitochondrial biogenesis [BR:dle03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    111173555 (VDAC3)
Ion channels [BR:dle04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   111173555 (VDAC3)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 111173555
NCBI-ProteinID: XP_022427036
UniProt: A0A2Y9N6K1
LinkDB
Position
Unknown
AA seq 283 aa
MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLRTKSCSGVEFSTSGHAYTDTGKASGNLET
KYKICNYGLTFTQKWNTDNTLGTEVSLENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKR
DCFSLGSNVDIDLSGPTIYGWAVLAIEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQL
HTHVNDGTEFGGSIYQKVNEKIETSINLAWTAGSNNTRFGIAAKYKLDCRTSLCAKVNNA
SLIGLGYTQTLRPGVKLTLSALIDGKNFNAGGHKVGLGFELEA
NT seq 852 nt   +upstreamnt  +downstreamnt
atgtgtaacacaccgacttactgtgacctaggaaaggctgccaaggatgtcttcaacaaa
ggatatggatttggcatggtcaaaatagatctgagaaccaagtcatgtagtggagtggaa
ttttctacttctggtcatgcttacactgatacagggaaagcatcaggcaacctagagacc
aaatacaagatttgtaactatggactgaccttcacccaaaagtggaacacagacaatact
cttgggacagaagtctctttggagaataagttggctgaagggttgaaactgactcttgat
accatatttgtaccgaacacaggaaagaagagtgggaaattgaaggcctcctataaacgg
gattgtttcagtcttggcagtaatgttgatatagatctttctggaccaaccatctacggc
tgggctgtgttggccattgaaggttggcttgctggctatcagatgagttttgacacagcc
aaatccaaactgtcacagaataatttcgccctgggttacaaggctgcagacttccagctg
cacactcacgtgaacgatggcactgaatttggagggtcgatctaccagaaggtgaacgag
aagattgaaacatcaataaacctcgcgtggacggctggcagtaacaacacccgtttcggc
atcgccgctaagtacaagctggactgtagaacttctctatgtgctaaagtgaataatgcc
agcctgattggactgggttatactcagacccttcgaccaggagtgaaactgaccctgtca
gctctaatcgatggaaagaacttcaatgcaggagggcacaaggtcgggctgggatttgaa
ctagaagcttaa

KEGG   Delphinapterus leucas (beluga whale): 111187864
Entry
111187864         CDS       T05885                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent anion-selective channel protein 3-like
  KO
K15041  voltage-dependent anion channel protein 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04020  Calcium signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04216  Ferroptosis
dle04217  Necroptosis
dle04218  Cellular senescence
dle04621  NOD-like receptor signaling pathway
dle04979  Cholesterol metabolism
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05016  Huntington disease
dle05017  Spinocerebellar ataxia
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05161  Hepatitis B
dle05166  Human T-cell leukemia virus 1 infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    111187864
   04022 cGMP-PKG signaling pathway
    111187864
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    111187864
   04217 Necroptosis
    111187864
   04218 Cellular senescence
    111187864
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111187864
  09154 Digestive system
   04979 Cholesterol metabolism
    111187864
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111187864
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111187864
   05012 Parkinson disease
    111187864
   05016 Huntington disease
    111187864
   05017 Spinocerebellar ataxia
    111187864
   05020 Prion disease
    111187864
   05022 Pathways of neurodegeneration - multiple diseases
    111187864
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111187864
   05161 Hepatitis B
    111187864
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dle03029]
    111187864
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dle04040]
    111187864
Mitochondrial biogenesis [BR:dle03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    111187864
Ion channels [BR:dle04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   111187864
SSDB
Motif
Pfam: Porin_3 Porin_4
Other DBs
NCBI-GeneID: 111187864
NCBI-ProteinID: XP_030619326
LinkDB
Position
Unknown
AA seq 422 aa
MKPLSSLRIHLEPPADFMLTLEKDLNVKLALLDINVCHIYSKEIHAGLQNSSLFLSLKPT
FHQEAGAEISSCSPRDKPRIRSSKVQEGKMSRRTAQATPATEDYTSRGPTLGWGSSEECG
GVGTLNGALAERTGHPVRDTCNTPSYCDLGKSAKDVFSKGYGFSMVKIDLRTKLCSGVEF
STSGHAYTVTGKALGNLETKYKICGYGLTFTQKXNTDNTLGTAISLENKLTQGLKLTLDT
IFVPNTGKKSGKLKASYKQDCFSLGNNVGIDFSGQTIYGWAVLAFEGWLAGYQMSLDTAK
LKLSQNNFTLGYRAADYQLHTHMNDGIEFGGWIYQKVNKKIETSINLAWTAGRNNTRFGI
AVKYKLDCRTSLSAKVNNASLIGLGCTQALQPGVKLTLSALIHGKNFSAGGHKVGLGFEL
EA
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgaagcctttgtcttctttaagaattcatcttgaaccaccggccgatttcatgttaaca
ttagaaaaggatctaaatgttaaactggccttgcttgacatcaacgtctgccacatttat
tccaaggagatacacgctgggctgcagaactcctctctttttctcagcctcaaacccacc
ttccatcaagaggcgggcgcggagatctcatcttgcagcccccgtgacaagcctcgtatt
cgctccagcaaagtgcaagagggcaagatgtcccggagaactgcacaggccaccccagcc
actgaagactacacatctcgaggaccaaccctaggctggggctccagtgaggaatgtggg
ggggtgggaacgttaaacggtgccctggcggagcggacgggccatcccgtcagagatacg
tgtaacacgccgtcttactgtgacctaggaaagtctgccaaggatgtcttcagcaaagga
tatgggtttagcatggtcaaaatagatctgagaaccaaattatgtagtggagtggaattt
tctacttctggtcatgcttacactgttacagggaaagcattaggcaacctagaaaccaaa
tacaagatttgtggctacgggctgaccttcacccaaaagtagaacacagacaatactttg
gggacagcaatctctttggagaataaattaactcaagggttgaaactgactctcgatacc
atatttgtcccaaacacaggaaagaagagtgggaaactgaaggcctcctataaacaggat
tgtttcagtcttggcaataatgttggtatagatttttctggacaaaccatctatggctgg
gctgtgttggcctttgaaggttggcttgctggctatcagatgagtttagacacagccaaa
ttgaaactgtcacagaataatttcaccctgggttacagggccgcagactaccagctgcat
actcacatgaacgatggcattgaatttggagggtggatctaccagaaggtgaacaagaag
attgaaacatcaataaacctcgcgtggacagcaggcaggaacaacacacgtttcggcatc
gctgttaagtacaagctggattgtagaacttctctatctgctaaagtaaataatgccagc
ctgattggactgggttgtactcaggcccttcaaccaggagtgaaactgaccctgtcagct
ctcatccatggaaagaacttcagtgcaggaggacacaaggtcgggctgggatttgaacta
gaagcttaa

DBGET integrated database retrieval system