KEGG   Delphinapterus leucas (beluga whale): 111173763
Entry
111173763         CDS       T05885                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle01524  Platinum drug resistance
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04115  p53 signaling pathway
dle04120  Ubiquitin mediated proteolysis
dle04144  Endocytosis
dle04151  PI3K-Akt signaling pathway
dle04218  Cellular senescence
dle04625  C-type lectin receptor signaling pathway
dle04919  Thyroid hormone signaling pathway
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05203  Viral carcinogenesis
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05219  Bladder cancer
dle05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111173763 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111173763 (MDM2)
   04151 PI3K-Akt signaling pathway
    111173763 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111173763 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    111173763 (MDM2)
   04115 p53 signaling pathway
    111173763 (MDM2)
   04218 Cellular senescence
    111173763 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111173763 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111173763 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111173763 (MDM2)
   05202 Transcriptional misregulation in cancer
    111173763 (MDM2)
   05206 MicroRNAs in cancer
    111173763 (MDM2)
   05205 Proteoglycans in cancer
    111173763 (MDM2)
   05203 Viral carcinogenesis
    111173763 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    111173763 (MDM2)
   05220 Chronic myeloid leukemia
    111173763 (MDM2)
   05218 Melanoma
    111173763 (MDM2)
   05219 Bladder cancer
    111173763 (MDM2)
   05215 Prostate cancer
    111173763 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111173763 (MDM2)
   05169 Epstein-Barr virus infection
    111173763 (MDM2)
   05165 Human papillomavirus infection
    111173763 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111173763 (MDM2)
   01522 Endocrine resistance
    111173763 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111173763 (MDM2)
   04121 Ubiquitin system [BR:dle04121]
    111173763 (MDM2)
Enzymes [BR:dle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111173763 (MDM2)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    111173763 (MDM2)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    111173763 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 111173763
NCBI-ProteinID: XP_022427287
UniProt: A0A2Y9NDG7
LinkDB
Position
Unknown
AA seq 491 aa
MCNTNMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVIVNQQEPSDSGT
SVSENRCHLEGGSVQKDLVQELQEEKPSSSDLVSRPSTSSRRRAVSETEENSDELPGERQ
RKRHKSDNISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCSEMNPPLPPHCNRCWALRENWLPEDKGKDKGKMSEKAKLENSAQVEEGFDVP
DCKKSTVNDSKESCVEENDDKITQASLSQESEDYSQPSTSNSIIYSSQEDVKELEREETQ
DKEENVESSFPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctactgatggtgctgtaagcacctcacagattcca
gcttcggaacaagagaccctggttagaccaaagccattgcttttgaagttgttgaagtct
gttggtgcacagaaggacacctatactatgaaagaggttatattttatcttggccagtat
attatgactaaacgattatatgatgagaaacaacagcatattgtgtattgttcaaatgat
cttctaggggatttatttggagtgccaagcttctctgtgaaagagcacaggaaaatatat
acaatgatttatagaaacttggtgatagtcaatcagcaggaaccatcagattcaggcaca
tctgtgagtgaaaacaggtgtcaccttgaaggtgggagtgttcaaaaggaccttgtgcaa
gagctacaggaagagaaaccttcatcttcagatttggtttctagaccatctacctcatct
agaaggagagcagttagtgagacagaagaaaattcagatgaattacctggtgaacgacaa
agaaagcgccacaaatctgataatatttccctttcctttgatgaaagccttgctctgtgt
gtaataagggagatatgttgtgaaagaagcagtagcagtgaatcgacagggactccatca
aatccggatcttgatgctggtgtaagtgaacattcaggtgattggttggatcaggattca
gtttcagatcaattcagtgtagaatttgaagttgagtctctggattcagaagattatagc
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtatatcgagttactgtg
tatcaggcaggggagagtgatacagattcatttgaagaagatcctgaaatttccttagct
gactattggaaatgtacttcatgcagtgaaatgaatcctccccttccacctcattgcaac
agatgttgggcccttcgtgaaaattggcttcctgaagataaagggaaagataaagggaaa
atgtctgagaaagccaaactagaaaactcagcacaagtagaagagggctttgatgtccct
gactgtaagaaatctacagtgaatgattccaaagaatcatgtgttgaggaaaatgatgat
aagatcacacaagcctccctatcccaagaaagtgaggactattctcagccatcaacatct
aatagtatcatttatagtagccaagaagatgtcaaagagttggagagggaagaaacacaa
gacaaagaagaaaatgtggaatctagttttcctcttaatgccattgaaccttgtgtgatt
tgccaaggtcgacctaaaaatggttgcatagtccatggcaaaacaggacatcttatggca
tgctttacatgtgcaaagaagctaaagaaaaggaataagccctgccccgtatgcagacaa
ccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system