Delphinapterus leucas (beluga whale): 111173770 Help Entry 111173770         CDS       T05885                                  Gene name IFNG Definition (RefSeq) interferon gamma   KO K04687   interferon gamma Organism dle  Delphinapterus leucas (beluga whale) Pathway dle03050   Proteasome dle04060   Cytokine-cytokine receptor interaction dle04066   HIF-1 signaling pathway dle04217   Necroptosis dle04350   TGF-beta signaling pathway dle04380   Osteoclast differentiation dle04612   Antigen processing and presentation dle04630   JAK-STAT signaling pathway dle04650   Natural killer cell mediated cytotoxicity dle04657   IL-17 signaling pathway dle04658   Th1 and Th2 cell differentiation dle04659   Th17 cell differentiation dle04660   T cell receptor signaling pathway dle04940   Type I diabetes mellitus dle05140   Leishmaniasis dle05142   Chagas disease dle05143   African trypanosomiasis dle05144   Malaria dle05145   Toxoplasmosis dle05146   Amoebiasis dle05152   Tuberculosis dle05160   Hepatitis C dle05164   Influenza A dle05168   Herpes simplex virus 1 infection dle05200   Pathways in cancer dle05235   PD-L1 expression and PD-1 checkpoint pathway in cancer dle05321   Inflammatory bowel disease dle05322   Systemic lupus erythematosus dle05323   Rheumatoid arthritis dle05330   Allograft rejection dle05332   Graft-versus-host disease dle05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     111173770 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     111173770 (IFNG)    04630 JAK-STAT signaling pathway     111173770 (IFNG)    04066 HIF-1 signaling pathway     111173770 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111173770 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     111173770 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     111173770 (IFNG)    04612 Antigen processing and presentation     111173770 (IFNG)    04660 T cell receptor signaling pathway     111173770 (IFNG)    04658 Th1 and Th2 cell differentiation     111173770 (IFNG)    04659 Th17 cell differentiation     111173770 (IFNG)    04657 IL-17 signaling pathway     111173770 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     111173770 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111173770 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     111173770 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     111173770 (IFNG)    05323 Rheumatoid arthritis     111173770 (IFNG)    05321 Inflammatory bowel disease     111173770 (IFNG)    05330 Allograft rejection     111173770 (IFNG)    05332 Graft-versus-host disease     111173770 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     111173770 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     111173770 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     111173770 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     111173770 (IFNG)    05164 Influenza A     111173770 (IFNG)    05168 Herpes simplex virus 1 infection     111173770 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     111173770 (IFNG)    05144 Malaria     111173770 (IFNG)    05145 Toxoplasmosis     111173770 (IFNG)    05140 Leishmaniasis     111173770 (IFNG)    05142 Chagas disease     111173770 (IFNG)    05143 African trypanosomiasis     111173770 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:dle03051]     111173770 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:dle04052]     111173770 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:dle00536]     111173770 (IFNG) Proteasome [BR:dle03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     111173770 (IFNG) Cytokines and growth factors [BR:dle04052]  Cytokines   Interferons    111173770 (IFNG) Glycosaminoglycan binding proteins [BR:dle00536]  Heparan sulfate / Heparin   Cytokines    111173770 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma API5 Motif Other DBs NCBI-GeneID:  111173770 NCBI-ProteinID:  XP_022427303 UniProt:  A0A2Y9NDI2 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MKYTSYFLAFQLCVILGSSGSYCQAPFFKEIQNLKEYFNASNPDVAGGGPLFLEILENWK DESDKKIIQSQIVSFYFKLFENLKGNQIIQRSMDIIKQDMFQKFLNGSSEKLDDFKKLIQ IPVDDLQIQRKAISELIKVMKDLSPRSNLRKRRRSQNLFRGQRASK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaaatataccagttatttcttagcttttcagctatgcgtgattttgggttcttctggc tcttactgccaggccccattttttaaagaaatacagaacctaaaggaatattttaatgca agtaacccagatgtagctggtggtgggcctcttttcttagaaattttggagaattggaaa gatgagagtgacaaaaaaataattcagagccaaatcgtctccttctacttcaaactcttt gaaaacttaaaaggtaaccagatcattcaaaggagcatggatatcatcaagcaggacatg tttcagaagttcttaaatggcagctctgagaaactggatgacttcaaaaagctgattcaa attccggtagatgatctgcagatccagcgcaaagccataagtgaactcatcaaagtgatg aaggacctgtcgccaagatctaacctcagaaagcggaggagaagtcagaatctgtttcga ggccagagagcgtcgaaataa

DBGET integrated database retrieval system