KEGG   Delphinapterus leucas (beluga whale): 111173770
Entry
111173770         CDS       T05885                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle03050  Proteasome
dle04060  Cytokine-cytokine receptor interaction
dle04066  HIF-1 signaling pathway
dle04217  Necroptosis
dle04350  TGF-beta signaling pathway
dle04380  Osteoclast differentiation
dle04612  Antigen processing and presentation
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04940  Type I diabetes mellitus
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05143  African trypanosomiasis
dle05144  Malaria
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05164  Influenza A
dle05168  Herpes simplex virus 1 infection
dle05200  Pathways in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05321  Inflammatory bowel disease
dle05322  Systemic lupus erythematosus
dle05323  Rheumatoid arthritis
dle05330  Allograft rejection
dle05332  Graft-versus-host disease
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    111173770 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    111173770 (IFNG)
   04630 JAK-STAT signaling pathway
    111173770 (IFNG)
   04066 HIF-1 signaling pathway
    111173770 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111173770 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111173770 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111173770 (IFNG)
   04612 Antigen processing and presentation
    111173770 (IFNG)
   04660 T cell receptor signaling pathway
    111173770 (IFNG)
   04658 Th1 and Th2 cell differentiation
    111173770 (IFNG)
   04659 Th17 cell differentiation
    111173770 (IFNG)
   04657 IL-17 signaling pathway
    111173770 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111173770 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111173770 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111173770 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    111173770 (IFNG)
   05323 Rheumatoid arthritis
    111173770 (IFNG)
   05321 Inflammatory bowel disease
    111173770 (IFNG)
   05330 Allograft rejection
    111173770 (IFNG)
   05332 Graft-versus-host disease
    111173770 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111173770 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111173770 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111173770 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111173770 (IFNG)
   05164 Influenza A
    111173770 (IFNG)
   05168 Herpes simplex virus 1 infection
    111173770 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111173770 (IFNG)
   05144 Malaria
    111173770 (IFNG)
   05145 Toxoplasmosis
    111173770 (IFNG)
   05140 Leishmaniasis
    111173770 (IFNG)
   05142 Chagas disease
    111173770 (IFNG)
   05143 African trypanosomiasis
    111173770 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:dle03051]
    111173770 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111173770 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111173770 (IFNG)
Proteasome [BR:dle03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111173770 (IFNG)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111173770 (IFNG)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Cytokines
   111173770 (IFNG)
SSDB
Motif
Pfam: IFN-gamma API5
Other DBs
NCBI-GeneID: 111173770
NCBI-ProteinID: XP_022427303
UniProt: A0A2Y9NDI2
LinkDB
Position
Unknown
AA seq 166 aa
MKYTSYFLAFQLCVILGSSGSYCQAPFFKEIQNLKEYFNASNPDVAGGGPLFLEILENWK
DESDKKIIQSQIVSFYFKLFENLKGNQIIQRSMDIIKQDMFQKFLNGSSEKLDDFKKLIQ
IPVDDLQIQRKAISELIKVMKDLSPRSNLRKRRRSQNLFRGQRASK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaaatataccagttatttcttagcttttcagctatgcgtgattttgggttcttctggc
tcttactgccaggccccattttttaaagaaatacagaacctaaaggaatattttaatgca
agtaacccagatgtagctggtggtgggcctcttttcttagaaattttggagaattggaaa
gatgagagtgacaaaaaaataattcagagccaaatcgtctccttctacttcaaactcttt
gaaaacttaaaaggtaaccagatcattcaaaggagcatggatatcatcaagcaggacatg
tttcagaagttcttaaatggcagctctgagaaactggatgacttcaaaaagctgattcaa
attccggtagatgatctgcagatccagcgcaaagccataagtgaactcatcaaagtgatg
aaggacctgtcgccaagatctaacctcagaaagcggaggagaagtcagaatctgtttcga
ggccagagagcgtcgaaataa

DBGET integrated database retrieval system