KEGG   Delphinapterus leucas (beluga whale): 111173782
Entry
111173782         CDS       T05885                                 

Gene name
HMGA2
Definition
(RefSeq) high mobility group protein HMGI-C
  KO
K09283  high mobility group AT-hook protein 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle05202  Transcriptional misregulation in cancer
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111173782 (HMGA2)
   05206 MicroRNAs in cancer
    111173782 (HMGA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111173782 (HMGA2)
   03036 Chromosome and associated proteins [BR:dle03036]
    111173782 (HMGA2)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Other transcription factors
   HMGI(Y)
    111173782 (HMGA2)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    111173782 (HMGA2)
SSDB
Motif
Pfam: AT_hook DUF5681
Other DBs
NCBI-GeneID: 111173782
NCBI-ProteinID: XP_022427317
UniProt: A0A2Y9N7D2
LinkDB
Position
Unknown
AA seq 109 aa
MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSP
SKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED
NT seq 330 nt   +upstreamnt  +downstreamnt
atgagcgcacgcggtgaaggcgccgggcagccgtccacttcagcccagggacaacctgcc
gccccggcgcctcagaagagaggacgcggccgacccaggaagcagcagcaagagccaacc
ggtgagccctctcctaagagaccaaggggaagacccaaaggcagcaaaaacaagagcccc
tccaaagcagctcaaaagaaagcagaagccactggagaaaaacggccaagaggcagacct
aggaaatggcctcaacaagttgttcagaagaagcctgctcaggaggagactgaagagaca
tcctcacaagagtctgcggaagaggattag

DBGET integrated database retrieval system