KEGG   Delphinapterus leucas (beluga whale): 111173824
Entry
111173824         CDS       T05885                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4 isoform X1
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04110  Cell cycle
dle04115  p53 signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04218  Cellular senescence
dle04530  Tight junction
dle04660  T cell receptor signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04934  Cushing syndrome
dle05160  Hepatitis C
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05212  Pancreatic cancer
dle05214  Glioma
dle05218  Melanoma
dle05219  Bladder cancer
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111173824 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111173824 (CDK4)
   04115 p53 signaling pathway
    111173824 (CDK4)
   04218 Cellular senescence
    111173824 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111173824 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    111173824 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111173824 (CDK4)
   05203 Viral carcinogenesis
    111173824 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111173824 (CDK4)
   05225 Hepatocellular carcinoma
    111173824 (CDK4)
   05214 Glioma
    111173824 (CDK4)
   05220 Chronic myeloid leukemia
    111173824 (CDK4)
   05218 Melanoma
    111173824 (CDK4)
   05219 Bladder cancer
    111173824 (CDK4)
   05224 Breast cancer
    111173824 (CDK4)
   05222 Small cell lung cancer
    111173824 (CDK4)
   05223 Non-small cell lung cancer
    111173824 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111173824 (CDK4)
   04934 Cushing syndrome
    111173824 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111173824 (CDK4)
   05160 Hepatitis C
    111173824 (CDK4)
   05164 Influenza A
    111173824 (CDK4)
   05162 Measles
    111173824 (CDK4)
   05163 Human cytomegalovirus infection
    111173824 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111173824 (CDK4)
   05169 Epstein-Barr virus infection
    111173824 (CDK4)
   05165 Human papillomavirus infection
    111173824 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111173824 (CDK4)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     111173824 (CDK4)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CMGC group
  CDK family
   111173824 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 111173824
NCBI-ProteinID: XP_022427398
UniProt: A0A2Y9MY60
LinkDB
Position
Unknown
AA seq 303 aa
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG
NPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctacccctcgatatgagccagtggctgagattggtgttggtgcctatgggacggtg
tataaggcccgtgatccccacagtggccactttgtggccctcaagagcgtaagagtcccc
aatggaggaggtgctggagggggcctgcccatcagcacagtccgtgaggtggctttactg
cggcggctggaggcttttgagcatcccaatgttgtgcggctgatggacgtctgtgccaca
gcccgaactgaccgggagaccaaagtgaccctggtgtttgagcatgtggaccaagaccta
aggacatatctggacaaggcacccccgccaggcttgccagtggagaccatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgccaactgcatcgttcatcgagac
ttgaagccagagaacattctggtgacaagtggtgggacagtcaagctggccgactttggc
ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtac
cgtgctccagaagttcttttgcagtctacatatgcaacacctgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgatcggactgcccccagaggatgactggccccga
gatgtgtctctaccccgaggagccttttcccccagagggccccgccccgtgcagtcggtg
gtacctgagatggaagagtctggggcacagctgctgctggagatgctgacttttaaccca
cacaagcggatctctgccttccgagccctgcagcactcctatctacataaggcagaaggt
aacccagagtga

KEGG   Delphinapterus leucas (beluga whale): 111173897
Entry
111173897         CDS       T05885                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2 isoform X1
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04114  Oocyte meiosis
dle04115  p53 signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04218  Cellular senescence
dle04914  Progesterone-mediated oocyte maturation
dle04934  Cushing syndrome
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05215  Prostate cancer
dle05222  Small cell lung cancer
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111173897 (CDK2)
   04151 PI3K-Akt signaling pathway
    111173897 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111173897 (CDK2)
   04114 Oocyte meiosis
    111173897 (CDK2)
   04115 p53 signaling pathway
    111173897 (CDK2)
   04218 Cellular senescence
    111173897 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    111173897 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111173897 (CDK2)
   05203 Viral carcinogenesis
    111173897 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    111173897 (CDK2)
   05215 Prostate cancer
    111173897 (CDK2)
   05222 Small cell lung cancer
    111173897 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111173897 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111173897 (CDK2)
   05161 Hepatitis B
    111173897 (CDK2)
   05160 Hepatitis C
    111173897 (CDK2)
   05162 Measles
    111173897 (CDK2)
   05169 Epstein-Barr virus infection
    111173897 (CDK2)
   05165 Human papillomavirus infection
    111173897 (CDK2)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     111173897 (CDK2)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CMGC group
  CDK family
   111173897 (CDK2)
DNA replication proteins [BR:dle03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    111173897 (CDK2)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111173897 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 111173897
NCBI-ProteinID: XP_022427613
UniProt: A0A2Y9N0A8
LinkDB
Position
Unknown
AA seq 346 aa
MENFQKVEKIGEGTYGVVYKAKNKVTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMHLVCTQHHARCCGEHRRNGRHSLCPLCSYLEVAAPQGGGMTAVS
TPHPVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVV
PPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccaaaaacaaggtgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag
acggagggtgtacccagtactgccatacgagagatctctctgctaaaggagcttaaccac
cctaatattgtcaagctgctggatgtcattcatacagaaaacaaactctacctggttttt
gagtttctgcaccaggatctcaagaaattcatggatgcctctgctctcactggcattcct
cttcccctcataaagagctatctgttccagctgctccagggcctagctttctgccattct
catcgggtcctgcaccgagacctcaaacctcagaatctgcttatcaacgcagagggggcc
atcaagctagcagactttggactagccagagcctttggagtccctgttcgtacttacacc
cacgaggtggtgactctgtggtaccgagcacctgaaatccttctgggctgcaaatactac
tccacagctgtggacatctggagcctgggctgcatctttgctgagatgcacctagtgtgt
acccagcaccatgctaggtgctgtggggaacacagaagaaatggaagacacagtctctgc
ccgctgtgctcctatctagaagtggctgcaccacaaggaggggggatgaccgcagtgtct
accccacaccccgtgacccggcgggccctattcccaggagattctgagatcgaccaactc
ttccggatctttcggactctggggaccccagatgaggtggtttggccaggagttacttct
atgcctgattataagccaagtttccccaagtgggccaggcaagattttagcaaagttgtg
ccccccctggatgaagatggacggagcttgttatcgcaaatgctgcactacgaccccaac
aagcggatttcagcaaaggcagctttggctcaccctttcttccaggatgtgaccaagcca
gtacctcaccttcgactctga

KEGG   Delphinapterus leucas (beluga whale): 111180943
Entry
111180943         CDS       T05885                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6 isoform X1
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04115  p53 signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04218  Cellular senescence
dle04934  Cushing syndrome
dle05160  Hepatitis C
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05206  MicroRNAs in cancer
dle05212  Pancreatic cancer
dle05214  Glioma
dle05218  Melanoma
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111180943 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111180943 (CDK6)
   04115 p53 signaling pathway
    111180943 (CDK6)
   04218 Cellular senescence
    111180943 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111180943 (CDK6)
   05206 MicroRNAs in cancer
    111180943 (CDK6)
   05203 Viral carcinogenesis
    111180943 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111180943 (CDK6)
   05225 Hepatocellular carcinoma
    111180943 (CDK6)
   05214 Glioma
    111180943 (CDK6)
   05220 Chronic myeloid leukemia
    111180943 (CDK6)
   05218 Melanoma
    111180943 (CDK6)
   05224 Breast cancer
    111180943 (CDK6)
   05222 Small cell lung cancer
    111180943 (CDK6)
   05223 Non-small cell lung cancer
    111180943 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111180943 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111180943 (CDK6)
   05164 Influenza A
    111180943 (CDK6)
   05162 Measles
    111180943 (CDK6)
   05163 Human cytomegalovirus infection
    111180943 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111180943 (CDK6)
   05169 Epstein-Barr virus infection
    111180943 (CDK6)
   05165 Human papillomavirus infection
    111180943 (CDK6)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     111180943 (CDK6)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CMGC group
  CDK family
   111180943 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 111180943
NCBI-ProteinID: XP_022441559
UniProt: A0A2Y9P3B0
LinkDB
Position
Unknown
AA seq 326 aa
MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSPQPIEKFVTDIDEQGKDLLLKCLTFNPAKRISAYSALSHPYF
HDLERCKENLDAHLPPSQNSSEMNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgagccgtgccgaccagcagtacgaatgcgtggcggagatcggg
gagggcgcctatgggaaggtgttcaaggcccgggacctgaagaacggaggccgtttcgtg
gcgctgaagcgcgtgcgagtgcagaccggcgaggagggcatgccgctctctaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtgtgcacagtgtcacgaacagacagagaaaccaaactaacattagtgtttgaacat
gttgatcaagacttgaccacttatttggataaagttccagagcctggagtgcccactgaa
accataaaggatatgatgtttcagcttctccgaggtctggactttcttcattctcaccga
gtggtacatcgtgatctaaaaccacagaacattctggtgaccagcagtggacaaataaaa
ctggctgacttcggccttgcccgcatctacagttttcagatggctcttacctcagtggtc
gtcacgctgtggtacagagctccagaagtcttgcttcagtccagctacgccacccctgtg
gacctctggagtgttggttgcatatttgcagaaatgtttcgtagaaagccgctttttcgt
ggaagttcagatgtcgatcagctaggaaaaatcttggatgtaattggactcccaggagaa
gaggactggcctagagatgttgccctccccaggcaggcttttcactcaaaatctcctcaa
ccaattgagaagtttgtaacagatattgatgaacaaggcaaagacctacttctgaagtgc
ttgacatttaatccagccaaaagaatatcggcctacagtgccctgtctcacccatacttc
cacgacctggagaggtgcaaggaaaacctggatgcccacctgccgcccagccagaacagc
tcagaaatgaatacagcctga

DBGET integrated database retrieval system