KEGG   Delphinapterus leucas (beluga whale): 111173839
Entry
111173839         CDS       T05885                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00562  Inositol phosphate metabolism
dle01100  Metabolic pathways
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle01524  Platinum drug resistance
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04070  Phosphatidylinositol signaling system
dle04071  Sphingolipid signaling pathway
dle04072  Phospholipase D signaling pathway
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04210  Apoptosis
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04218  Cellular senescence
dle04360  Axon guidance
dle04370  VEGF signaling pathway
dle04380  Osteoclast differentiation
dle04510  Focal adhesion
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04611  Platelet activation
dle04613  Neutrophil extracellular trap formation
dle04620  Toll-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle04668  TNF signaling pathway
dle04670  Leukocyte transendothelial migration
dle04722  Neurotrophin signaling pathway
dle04725  Cholinergic synapse
dle04750  Inflammatory mediator regulation of TRP channels
dle04810  Regulation of actin cytoskeleton
dle04910  Insulin signaling pathway
dle04914  Progesterone-mediated oocyte maturation
dle04915  Estrogen signaling pathway
dle04917  Prolactin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle04923  Regulation of lipolysis in adipocytes
dle04926  Relaxin signaling pathway
dle04929  GnRH secretion
dle04930  Type II diabetes mellitus
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle04960  Aldosterone-regulated sodium reabsorption
dle04973  Carbohydrate digestion and absorption
dle05010  Alzheimer disease
dle05017  Spinocerebellar ataxia
dle05020  Prion disease
dle05100  Bacterial invasion of epithelial cells
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05142  Chagas disease
dle05146  Amoebiasis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111173839 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111173839 (PIK3CA)
   04014 Ras signaling pathway
    111173839 (PIK3CA)
   04015 Rap1 signaling pathway
    111173839 (PIK3CA)
   04370 VEGF signaling pathway
    111173839 (PIK3CA)
   04630 JAK-STAT signaling pathway
    111173839 (PIK3CA)
   04668 TNF signaling pathway
    111173839 (PIK3CA)
   04066 HIF-1 signaling pathway
    111173839 (PIK3CA)
   04068 FoxO signaling pathway
    111173839 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    111173839 (PIK3CA)
   04072 Phospholipase D signaling pathway
    111173839 (PIK3CA)
   04071 Sphingolipid signaling pathway
    111173839 (PIK3CA)
   04024 cAMP signaling pathway
    111173839 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    111173839 (PIK3CA)
   04152 AMPK signaling pathway
    111173839 (PIK3CA)
   04150 mTOR signaling pathway
    111173839 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111173839 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    111173839 (PIK3CA)
   04218 Cellular senescence
    111173839 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111173839 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    111173839 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111173839 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111173839 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    111173839 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    111173839 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    111173839 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    111173839 (PIK3CA)
   04660 T cell receptor signaling pathway
    111173839 (PIK3CA)
   04662 B cell receptor signaling pathway
    111173839 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    111173839 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    111173839 (PIK3CA)
   04670 Leukocyte transendothelial migration
    111173839 (PIK3CA)
   04062 Chemokine signaling pathway
    111173839 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111173839 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    111173839 (PIK3CA)
   04929 GnRH secretion
    111173839 (PIK3CA)
   04915 Estrogen signaling pathway
    111173839 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    111173839 (PIK3CA)
   04917 Prolactin signaling pathway
    111173839 (PIK3CA)
   04926 Relaxin signaling pathway
    111173839 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    111173839 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    111173839 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111173839 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111173839 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    111173839 (PIK3CA)
   04722 Neurotrophin signaling pathway
    111173839 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111173839 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    111173839 (PIK3CA)
   04380 Osteoclast differentiation
    111173839 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    111173839 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    111173839 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111173839 (PIK3CA)
   05206 MicroRNAs in cancer
    111173839 (PIK3CA)
   05205 Proteoglycans in cancer
    111173839 (PIK3CA)
   05203 Viral carcinogenesis
    111173839 (PIK3CA)
   05230 Central carbon metabolism in cancer
    111173839 (PIK3CA)
   05231 Choline metabolism in cancer
    111173839 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111173839 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111173839 (PIK3CA)
   05212 Pancreatic cancer
    111173839 (PIK3CA)
   05225 Hepatocellular carcinoma
    111173839 (PIK3CA)
   05226 Gastric cancer
    111173839 (PIK3CA)
   05214 Glioma
    111173839 (PIK3CA)
   05221 Acute myeloid leukemia
    111173839 (PIK3CA)
   05220 Chronic myeloid leukemia
    111173839 (PIK3CA)
   05218 Melanoma
    111173839 (PIK3CA)
   05211 Renal cell carcinoma
    111173839 (PIK3CA)
   05215 Prostate cancer
    111173839 (PIK3CA)
   05213 Endometrial cancer
    111173839 (PIK3CA)
   05224 Breast cancer
    111173839 (PIK3CA)
   05222 Small cell lung cancer
    111173839 (PIK3CA)
   05223 Non-small cell lung cancer
    111173839 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111173839 (PIK3CA)
   05017 Spinocerebellar ataxia
    111173839 (PIK3CA)
   05020 Prion disease
    111173839 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111173839 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111173839 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    111173839 (PIK3CA)
   04931 Insulin resistance
    111173839 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111173839 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111173839 (PIK3CA)
   05135 Yersinia infection
    111173839 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    111173839 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111173839 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    111173839 (PIK3CA)
   05161 Hepatitis B
    111173839 (PIK3CA)
   05160 Hepatitis C
    111173839 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    111173839 (PIK3CA)
   05164 Influenza A
    111173839 (PIK3CA)
   05162 Measles
    111173839 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    111173839 (PIK3CA)
   05163 Human cytomegalovirus infection
    111173839 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111173839 (PIK3CA)
   05169 Epstein-Barr virus infection
    111173839 (PIK3CA)
   05165 Human papillomavirus infection
    111173839 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111173839 (PIK3CA)
   05142 Chagas disease
    111173839 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111173839 (PIK3CA)
   01524 Platinum drug resistance
    111173839 (PIK3CA)
   01522 Endocrine resistance
    111173839 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111173839 (PIK3CA)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     111173839 (PIK3CA)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    111173839 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 111173839
NCBI-ProteinID: XP_022427455
UniProt: A0A2Y9MZW2
LinkDB
Position
Unknown
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatgggatgatagtgactttagaatgcctccgtgaggct
acattaataactataaagcatgaactatttaaagaagcgagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
attggcatgccagtgtgtgaattcgatatggttaaagatccagaagtacaggacttccga
agaaatattctcaatgtttgtaaagaagctgtggatcttagggatctcaattcaccgcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaattggataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaagaaaactcgaagtatgttgctatcatctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgacgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctctactctcaactgccaatggac
tgttttacaatgccatcttattccagacgcatctccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcacttagaataaaaattctttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattacgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttctatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggactagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgtttggagttggagtttgactggttc
agcagtgtggtaaagtttccagatatgtcagtgattgaagagcatgccaattggtctgtg
tcccgagaagcaggatttagttattcccatgcaggactgagtaacagactagctagagac
aatgaattaagagaaaatgataaagaacagctccgagcaatttgtacacgagatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgtaact
atccctgaaattctacccaaattgcttctgtctgttaaatggaattctagagatgaagta
gctcagatgtactgcttggtaaaagattggcctccaatcaaacctgaacaggctatggag
cttctggactgcaattacccagatcctatggttcgaggttttgctgttcgatgcttagaa
aaatatttaacagatgacaaactttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacagtatttggataacctacttgtgaggtttttactcaaaaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agtcagaggtttggcctgcttttggagtcctattgccgtgcatgtgggatgtatttgaag
cacctgaataggcaggttgaggctatggaaaagctcattaacttaactgacattctcaaa
caagagaagaaggatgaaacacaaaaggtacagatgaaatttttagttgagcaaatgcgg
cgaccagatttcatggatgctctacagggctttctgtcgcctctaaaccctgctcatcag
ctgggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagaattactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacgacaagatatgctaacacttcagattattcgcattatg
gaaaatatatggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtcc
attggtgactgtgtgggacttattgaggtggtgagaaattctcacactattatgcaaatt
cagtgtaaaggaggcctgaaaggtgccctgcagttcaacagccacacactacatcagtgg
ctcaaagacaagaacaagggagaaatatatgatgcagccatcgatctatttacacgttca
tgtgctggatattgtgttgctaccttcattttgggaattggagatcgtcacaatagtaac
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagagcgtgtgccatttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacagtcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgagcaggaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

KEGG   Delphinapterus leucas (beluga whale): 111179235
Entry
111179235         CDS       T05885                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00562  Inositol phosphate metabolism
dle01100  Metabolic pathways
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle01524  Platinum drug resistance
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04070  Phosphatidylinositol signaling system
dle04071  Sphingolipid signaling pathway
dle04072  Phospholipase D signaling pathway
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04210  Apoptosis
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04218  Cellular senescence
dle04360  Axon guidance
dle04370  VEGF signaling pathway
dle04380  Osteoclast differentiation
dle04510  Focal adhesion
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04611  Platelet activation
dle04613  Neutrophil extracellular trap formation
dle04620  Toll-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle04668  TNF signaling pathway
dle04670  Leukocyte transendothelial migration
dle04722  Neurotrophin signaling pathway
dle04725  Cholinergic synapse
dle04750  Inflammatory mediator regulation of TRP channels
dle04810  Regulation of actin cytoskeleton
dle04910  Insulin signaling pathway
dle04914  Progesterone-mediated oocyte maturation
dle04915  Estrogen signaling pathway
dle04917  Prolactin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle04923  Regulation of lipolysis in adipocytes
dle04926  Relaxin signaling pathway
dle04929  GnRH secretion
dle04930  Type II diabetes mellitus
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle04960  Aldosterone-regulated sodium reabsorption
dle04973  Carbohydrate digestion and absorption
dle05010  Alzheimer disease
dle05017  Spinocerebellar ataxia
dle05020  Prion disease
dle05100  Bacterial invasion of epithelial cells
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05142  Chagas disease
dle05146  Amoebiasis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111179235 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111179235 (PIK3CB)
   04014 Ras signaling pathway
    111179235 (PIK3CB)
   04015 Rap1 signaling pathway
    111179235 (PIK3CB)
   04370 VEGF signaling pathway
    111179235 (PIK3CB)
   04630 JAK-STAT signaling pathway
    111179235 (PIK3CB)
   04668 TNF signaling pathway
    111179235 (PIK3CB)
   04066 HIF-1 signaling pathway
    111179235 (PIK3CB)
   04068 FoxO signaling pathway
    111179235 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    111179235 (PIK3CB)
   04072 Phospholipase D signaling pathway
    111179235 (PIK3CB)
   04071 Sphingolipid signaling pathway
    111179235 (PIK3CB)
   04024 cAMP signaling pathway
    111179235 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    111179235 (PIK3CB)
   04152 AMPK signaling pathway
    111179235 (PIK3CB)
   04150 mTOR signaling pathway
    111179235 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111179235 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    111179235 (PIK3CB)
   04218 Cellular senescence
    111179235 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111179235 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    111179235 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111179235 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111179235 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    111179235 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    111179235 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    111179235 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    111179235 (PIK3CB)
   04660 T cell receptor signaling pathway
    111179235 (PIK3CB)
   04662 B cell receptor signaling pathway
    111179235 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    111179235 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    111179235 (PIK3CB)
   04670 Leukocyte transendothelial migration
    111179235 (PIK3CB)
   04062 Chemokine signaling pathway
    111179235 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111179235 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    111179235 (PIK3CB)
   04929 GnRH secretion
    111179235 (PIK3CB)
   04915 Estrogen signaling pathway
    111179235 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    111179235 (PIK3CB)
   04917 Prolactin signaling pathway
    111179235 (PIK3CB)
   04926 Relaxin signaling pathway
    111179235 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    111179235 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    111179235 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111179235 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111179235 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    111179235 (PIK3CB)
   04722 Neurotrophin signaling pathway
    111179235 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111179235 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    111179235 (PIK3CB)
   04380 Osteoclast differentiation
    111179235 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    111179235 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    111179235 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111179235 (PIK3CB)
   05206 MicroRNAs in cancer
    111179235 (PIK3CB)
   05205 Proteoglycans in cancer
    111179235 (PIK3CB)
   05203 Viral carcinogenesis
    111179235 (PIK3CB)
   05230 Central carbon metabolism in cancer
    111179235 (PIK3CB)
   05231 Choline metabolism in cancer
    111179235 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111179235 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111179235 (PIK3CB)
   05212 Pancreatic cancer
    111179235 (PIK3CB)
   05225 Hepatocellular carcinoma
    111179235 (PIK3CB)
   05226 Gastric cancer
    111179235 (PIK3CB)
   05214 Glioma
    111179235 (PIK3CB)
   05221 Acute myeloid leukemia
    111179235 (PIK3CB)
   05220 Chronic myeloid leukemia
    111179235 (PIK3CB)
   05218 Melanoma
    111179235 (PIK3CB)
   05211 Renal cell carcinoma
    111179235 (PIK3CB)
   05215 Prostate cancer
    111179235 (PIK3CB)
   05213 Endometrial cancer
    111179235 (PIK3CB)
   05224 Breast cancer
    111179235 (PIK3CB)
   05222 Small cell lung cancer
    111179235 (PIK3CB)
   05223 Non-small cell lung cancer
    111179235 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111179235 (PIK3CB)
   05017 Spinocerebellar ataxia
    111179235 (PIK3CB)
   05020 Prion disease
    111179235 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111179235 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111179235 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    111179235 (PIK3CB)
   04931 Insulin resistance
    111179235 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111179235 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111179235 (PIK3CB)
   05135 Yersinia infection
    111179235 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    111179235 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111179235 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    111179235 (PIK3CB)
   05161 Hepatitis B
    111179235 (PIK3CB)
   05160 Hepatitis C
    111179235 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    111179235 (PIK3CB)
   05164 Influenza A
    111179235 (PIK3CB)
   05162 Measles
    111179235 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    111179235 (PIK3CB)
   05163 Human cytomegalovirus infection
    111179235 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111179235 (PIK3CB)
   05169 Epstein-Barr virus infection
    111179235 (PIK3CB)
   05165 Human papillomavirus infection
    111179235 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111179235 (PIK3CB)
   05142 Chagas disease
    111179235 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111179235 (PIK3CB)
   01524 Platinum drug resistance
    111179235 (PIK3CB)
   01522 Endocrine resistance
    111179235 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111179235 (PIK3CB)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     111179235 (PIK3CB)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    111179235 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 111179235
NCBI-ProteinID: XP_022438316
UniProt: A0A2Y9NZC3
LinkDB
Position
Unknown
AA seq 1064 aa
MPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLWKQVHNY
PMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGEKLDSKI
GVLIGRGLHEFDALKDPEVNEFRIKMRRFSEEKIQSLVGLSWMDWLKQTYPPEHEPSIPE
NLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKINELAIQKRLTIHGKEDEVSPYDY
VLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKLYEQEMIAIEAAINR
NSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCK
TVVSSEISGKNDHIWNEPLEFDISTCDLPRMARLCFAVYAVLDKVKTKKSTKTINPSKYQ
TIRKSGKVDYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQTNPYTE
NATALHIRFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKEILDRDP
LSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKLPPREA
LELLDFNYPDQYVREYAVGCLQQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALA
NRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKALSKQVEALNKLKTLNSLI
KLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYIEKCKYMDSKMKPL
WLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGD
HSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEEFTLSCA
GYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIH
VIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQYLKD
SLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgcctcctgctatggcagacatccttgacatctgggcagtggattcacagatagcatct
gatggctccatacctgtggatttccttttgcccactgggatttatatccagttggaggta
cctcgggaagctaccatttcctatattaaacagatgttatggaaacaagttcataattac
ccaatgtttaacctccttatggaaattgactcctatatgtttgcatgtgtgaatcaaact
gctgtatatgaggagcttgaagatgaaacaagaagactctgtgatgtcagaccttttctt
ccagttctcaaattagtgacaagaagttgtgacccaggggaaaaattagactcaaaaatt
ggagtccttataggaagaggtttgcatgaatttgatgccttgaaggatcctgaggtgaat
gaattccgaataaaaatgcgcagattcagtgaggaaaagattcagtcgcttgtgggattg
tcttggatggattggctaaagcaaacctatccaccagagcatgaaccatccattcctgaa
aatttagaagataaactttacggaggaaagctcattgtggctgttcattttgaaaattgt
caggatgtgtttagctttcaagtatctcctaatatgaatcctatcaaaataaatgaattg
gcaatccaaaaacgtttgactattcatgggaaagaagatgaagttagcccctatgactat
gtgttgcaagtcagtgggagagtagaatatgtgtttggtgatcacccactaattcagttc
cagtatatccggaactgtgtaatgaataggaccttgccccattttatacttgtggaatgt
tgcaagatcaagaagctgtatgaacaggaaatgattgccatagaggctgccataaatcga
aattcatctaaccttcctcttcctttaccaccaaagaaaactcgaattatttctcatgtt
tgggaaaataacaaccctttccaaattgtcttggttaagggaaataaacttaacacagaa
gaaactgtaaaagttcatgtcagggctggcctttttcatggtaccgaactcctgtgtaaa
accgtcgtaagctcagagatatcagggaaaaacgatcatatttggaatgaaccactggaa
tttgatatcagtacttgtgacctgccacgaatggctcgattatgtttcgctgtttatgca
gttttggataaagtgaaaacgaagaaatcaactaaaactattaatccctctaaatatcag
accatcaggaaatctggaaaagtggattatcctgtagcctgggtaaatacgatggttttt
gactttaaaggacagttgagatctggagatataatattgcacagctggtcttcatttcct
gatgaacttgaagaaatgttgaatccaatgggaactgttcaaacaaatccatatactgaa
aatgcaacagctttgcacatcagattcccagagaataaaaaacaaccttattactatcct
ccctttgataagattattgaaaaggcagctgagattgcaagcagtgatagtgctaatgta
tcaagtcgaggtggaaagaagtttcttgctgtactgaaagaaatcttggacagggatccg
ttgtctcaactgtgtgagaatgaaatggatcttatttggactttgcgacaagactgcaga
gagaatttcccacagtcattgccaaaattactgctgtcaatcaagtggaataaacttgag
gatgttgctcagcttcaggcactacttcagatttggcctaaactgcccccccgggaggcc
ctggagcttctagatttcaactatccagatcagtacgtgcgagaatatgctgtgggctgt
ctgcaacagatgagtgatgaagaactctctcagtatcttttacagttggtgcaagtttta
aaatatgagccttttcttgattgtgccctctctagattcctactagaaagagcacttgct
aatcggaggatagggcagtttttattttggcaccttaggtcagaagtgcacattcctgct
gtttcagtacaatttggtgtcatccttgaagcatactgccggggaagcgtaggtcacatg
aaagcgctttccaagcaggttgaagcactcaataagttaaaaactttaaatagtttaatc
aaactgaatgcaatgaagctaaatagagccaaagggaaagaagcaatgcacacttgttta
aaacagaatgcttatcgggaagccctctctgacctgcaatcacctctgaacccatgtgtt
atcctctcagaactctatattgaaaagtgtaaatacatggattccaaaatgaagcctttg
tggctggtgtacaacaacaaggtgtttggtgaggattcagttggagtgatttttaaaaat
ggtgatgatttacggcaggatatgttgacactccaaatgctgcgcttgatggatttactc
tggaaagaagctggtctggatcttaggatgctgccttatggctgtttagcaacaggagac
cactctggcctcattgaagttgtgagcacctctgaaacaattgctgacattcagctgaac
agtagcaatgtggctgcagcagcagccttcaacaaagatgcccttctgaactggcttaaa
gaatacaattctggggatgacctggaccgagccattgaggagtttaccctgtcctgtgcc
ggctactgtgtagcttcttatgtccttgggattggtgacagacatagtgataacatcatg
gtcaaaaaaactggccagctcttccacattgactttggacatattcttggaaatttcaag
tctaaatttggcattaaaagggagagagtgccttttattcttacctatgatttcattcat
gtgattcaacaaggaaaaacaggaaacacggaaaagtttggccggttccgccagtgttgt
gaggatgcatatctgattttacgacggcatgggaatctcttcatcactctctttgcactg
atgttgactgcagggcttcctgagctcacatcagtcaaggatatacagtatcttaaggac
tctcttgccttagggaagagtgaagaagaagcactcaagcaatttaagcaaaaatttgat
gaggcactcagggaaagctggactactaaagtgaactggatggcccacacagttcggaaa
gactacagatcttaa

KEGG   Delphinapterus leucas (beluga whale): 111187262
Entry
111187262         CDS       T05885                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00562  Inositol phosphate metabolism
dle01100  Metabolic pathways
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle01524  Platinum drug resistance
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04070  Phosphatidylinositol signaling system
dle04071  Sphingolipid signaling pathway
dle04072  Phospholipase D signaling pathway
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04210  Apoptosis
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04218  Cellular senescence
dle04360  Axon guidance
dle04370  VEGF signaling pathway
dle04380  Osteoclast differentiation
dle04510  Focal adhesion
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04611  Platelet activation
dle04613  Neutrophil extracellular trap formation
dle04620  Toll-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle04668  TNF signaling pathway
dle04670  Leukocyte transendothelial migration
dle04722  Neurotrophin signaling pathway
dle04725  Cholinergic synapse
dle04750  Inflammatory mediator regulation of TRP channels
dle04810  Regulation of actin cytoskeleton
dle04910  Insulin signaling pathway
dle04914  Progesterone-mediated oocyte maturation
dle04915  Estrogen signaling pathway
dle04917  Prolactin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle04923  Regulation of lipolysis in adipocytes
dle04926  Relaxin signaling pathway
dle04929  GnRH secretion
dle04930  Type II diabetes mellitus
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle04960  Aldosterone-regulated sodium reabsorption
dle04973  Carbohydrate digestion and absorption
dle05010  Alzheimer disease
dle05017  Spinocerebellar ataxia
dle05020  Prion disease
dle05100  Bacterial invasion of epithelial cells
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05142  Chagas disease
dle05146  Amoebiasis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111187262 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111187262 (PIK3CD)
   04014 Ras signaling pathway
    111187262 (PIK3CD)
   04015 Rap1 signaling pathway
    111187262 (PIK3CD)
   04370 VEGF signaling pathway
    111187262 (PIK3CD)
   04630 JAK-STAT signaling pathway
    111187262 (PIK3CD)
   04668 TNF signaling pathway
    111187262 (PIK3CD)
   04066 HIF-1 signaling pathway
    111187262 (PIK3CD)
   04068 FoxO signaling pathway
    111187262 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    111187262 (PIK3CD)
   04072 Phospholipase D signaling pathway
    111187262 (PIK3CD)
   04071 Sphingolipid signaling pathway
    111187262 (PIK3CD)
   04024 cAMP signaling pathway
    111187262 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    111187262 (PIK3CD)
   04152 AMPK signaling pathway
    111187262 (PIK3CD)
   04150 mTOR signaling pathway
    111187262 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111187262 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    111187262 (PIK3CD)
   04218 Cellular senescence
    111187262 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111187262 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    111187262 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111187262 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111187262 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    111187262 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    111187262 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    111187262 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    111187262 (PIK3CD)
   04660 T cell receptor signaling pathway
    111187262 (PIK3CD)
   04662 B cell receptor signaling pathway
    111187262 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    111187262 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    111187262 (PIK3CD)
   04670 Leukocyte transendothelial migration
    111187262 (PIK3CD)
   04062 Chemokine signaling pathway
    111187262 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111187262 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    111187262 (PIK3CD)
   04929 GnRH secretion
    111187262 (PIK3CD)
   04915 Estrogen signaling pathway
    111187262 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    111187262 (PIK3CD)
   04917 Prolactin signaling pathway
    111187262 (PIK3CD)
   04926 Relaxin signaling pathway
    111187262 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    111187262 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    111187262 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111187262 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111187262 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    111187262 (PIK3CD)
   04722 Neurotrophin signaling pathway
    111187262 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111187262 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    111187262 (PIK3CD)
   04380 Osteoclast differentiation
    111187262 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    111187262 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    111187262 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111187262 (PIK3CD)
   05206 MicroRNAs in cancer
    111187262 (PIK3CD)
   05205 Proteoglycans in cancer
    111187262 (PIK3CD)
   05203 Viral carcinogenesis
    111187262 (PIK3CD)
   05230 Central carbon metabolism in cancer
    111187262 (PIK3CD)
   05231 Choline metabolism in cancer
    111187262 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111187262 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111187262 (PIK3CD)
   05212 Pancreatic cancer
    111187262 (PIK3CD)
   05225 Hepatocellular carcinoma
    111187262 (PIK3CD)
   05226 Gastric cancer
    111187262 (PIK3CD)
   05214 Glioma
    111187262 (PIK3CD)
   05221 Acute myeloid leukemia
    111187262 (PIK3CD)
   05220 Chronic myeloid leukemia
    111187262 (PIK3CD)
   05218 Melanoma
    111187262 (PIK3CD)
   05211 Renal cell carcinoma
    111187262 (PIK3CD)
   05215 Prostate cancer
    111187262 (PIK3CD)
   05213 Endometrial cancer
    111187262 (PIK3CD)
   05224 Breast cancer
    111187262 (PIK3CD)
   05222 Small cell lung cancer
    111187262 (PIK3CD)
   05223 Non-small cell lung cancer
    111187262 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111187262 (PIK3CD)
   05017 Spinocerebellar ataxia
    111187262 (PIK3CD)
   05020 Prion disease
    111187262 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111187262 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111187262 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    111187262 (PIK3CD)
   04931 Insulin resistance
    111187262 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111187262 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111187262 (PIK3CD)
   05135 Yersinia infection
    111187262 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    111187262 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111187262 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    111187262 (PIK3CD)
   05161 Hepatitis B
    111187262 (PIK3CD)
   05160 Hepatitis C
    111187262 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    111187262 (PIK3CD)
   05164 Influenza A
    111187262 (PIK3CD)
   05162 Measles
    111187262 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    111187262 (PIK3CD)
   05163 Human cytomegalovirus infection
    111187262 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111187262 (PIK3CD)
   05169 Epstein-Barr virus infection
    111187262 (PIK3CD)
   05165 Human papillomavirus infection
    111187262 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111187262 (PIK3CD)
   05142 Chagas disease
    111187262 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111187262 (PIK3CD)
   01524 Platinum drug resistance
    111187262 (PIK3CD)
   01522 Endocrine resistance
    111187262 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111187262 (PIK3CD)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     111187262 (PIK3CD)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    111187262 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 111187262
NCBI-ProteinID: XP_022454452
UniProt: A0A2Y9QGK3
LinkDB
Position
Unknown
AA seq 919 aa
MRQFCEEVAAHRQQLGWEAWLQYSFPLQLEPSARSWGPGTLRVPNRALLVNVKFEGSEES
FTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGKHEYLYGSHPLCQFQYI
CSCLHSRLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRAKPPPIPLKKPVSVSLWSLEQP
FCIELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSSSEVSVCSEPVWKQRLEFDISIG
DLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKNQLKTGERCLYMW
PSVPDEKGELLNPCGTVRSNPNTESAAALVIFLPEVAPHPIYYPALDKQLQLREILERRG
SGELYEHEKDLVWKMRHEIQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSA
LELLDFSFPDRHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALA
NRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDVV
KVSSQKTTKPQTKELMHLCMRQETYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPL
WVMYSNEEAGSDGTVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTG
DHTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSC
AGYCVATYVLGIGDRHSDNIMIRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFV
HVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLK
LPVEKAKPPAFGAKTSGLKLASYFEDGAGRGPPWLGSERRALPGGGAGWRPPGSLGAVLL
GGSVTCPERVEVQGDGAPC
NT seq 2760 nt   +upstreamnt  +downstreamnt
atgcgccagttctgcgaggaggtggccgcgcaccggcagcagctgggctgggaggcctgg
ctgcagtacagcttccccctgcagctggagccctcagcgcggagctgggggccgggcacc
ctgcgcgtccccaaccgggccctgctcgtcaacgtcaagttcgagggcagcgaggagagc
ttcaccttccaggtgtccaccaaggatgtgcccctggcactgatggcctgcgcactccgg
aagaaggccacggtgttccggcagccgctggtagagcagcccgaggactacacactacag
gtgaacgggaagcacgagtacctgtacggcagccaccccctctgccagttccagtacatc
tgcagctgcctgcacagcaggctgaccccccacctgaccatggtgcactcctcttccatc
ctcgccatgcgggacgagcagagcaaccccgccccccaagtccaaaagccacgcgccaaa
ccgccccccattcctctgaagaagcccgtctccgtgtccctgtggtccctggaacagcct
ttctgcatcgagctgatccagggcagcaaagtgaatgccgatgagcggatgaagctggtg
gtgcaggccggcctcttccatggcaacgagacgctgtgcaagacggtgtccagctcggag
gtgagcgtgtgctcagagcctgtgtggaagcagcggctggagttcgacatcagcatcggc
gacctaccgcgcatggcccgcctctgcttcgcgctctacgccgtgatcgagaaggccaag
aaggctcgctccaccaagaagaagtccaagaaggcggactgccccatcgcctgggccaac
ctcatgctgtttgattacaagaaccagctcaagaccggcgagcgctgcctctacatgtgg
ccctccgtcccagacgagaaaggggagctactgaacccctgtgggaccgtgcggagtaac
cccaacactgagagcgcagccgccctggtcatctttctccctgaggtggccccccaccct
atatactaccctgccctggacaagcagctacagctgcgggagatcctggagcgccggggc
tccggggagctgtacgagcacgagaaggacctggtgtggaagatgcggcacgagatccag
gagcacttccccgaggcgctggcccgcttgctgctggtcaccaagtggaacaagcacgag
gacgtggcccagatgctctacctgctgtgctcctggcccgagctgcccgtcctgagcgcc
ctggagctgctggacttcagcttccctgaccgccacgtgggctcctttgccatcaagtcc
ctgcggaaactgacggacgacgagcttttccagtacctgctgcagctggtgcaggtgctc
aagtacgagtcctacctcgactgcgagctgaccaaattcctgctggaccgggccctggcc
aatcgcaagatcggccacttcctcttctggcacctgcgctccgagatgcacgtgccctcg
gtggccctgcgctttggcctcatcatggaggcctactgcaggggcagcacccatcacatg
aaggtgctgatgaaacagggggaagcgctgagcaagctgaaagccctgaacgacgtcgtc
aaagtgagctcccagaagaccaccaagccccagaccaaggagctgatgcacctgtgcatg
cgccaggagacctacctggaggccctctcccacctgcagtccccactcgaccccagcacc
ctgctggctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaagcccctg
tgggtcatgtacagcaatgaggaggcgggcagcgatggcaccgtgggcatcatctttaag
aatggggacgacctccgccaggacatgctgaccctgcagatgatccagctgatggacgtt
ctgtggaagcaggagggcttggacctgaggatgaccccttacggctgcctctccaccggg
gaccacacaggcctcatcgaggtggtgcttcactcagacaccatcgccaacatccagctg
aacaagagcaacatggcggccacggctgccttcaacaaggatgctctgctcaactggctc
aagtccaagaaccctggggaggccctggatcgagccattgaggagttcaccctctcctgc
gctggctactgtgtggccacatacgtgctgggcatcggcgatcggcacagcgacaacatc
atgatccgagagaacgggcagctgttccacattgatttcggccactttctggggaatttc
aagaccaagtttggaatcaaccgtgagcgagtcccattcatcctcacctatgactttgtg
cacgtgatccagcaggggaagacgaataatagtgagaaatttgaaaggttccggggctac
tgtgaaagggcctacaccatcctgcggcgccacgggctgctctttctccacctctttgct
ctcatgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtacctcaag
cttccagtggagaaggccaagccgcctgccttcggggccaagacctccgggctcaagttg
gcatcttattttgaggatggggcggggcgggggccgccttggttggggtcggaacgaaga
gctcttcccgggggaggtgctgggtggcgccctcctggctcccttggtgcagttctctta
ggagggagcgttacctgcccagagagggtggaggtgcagggagacggggctccctgctga

DBGET integrated database retrieval system