KEGG   Delphinapterus leucas (beluga whale): 111173850Help
Entry
111173850         CDS       T05885                                 

Gene name
STAT6
Definition
(RefSeq) signal transducer and activator of transcription 6 isoform X4
  KO
K11225  signal transducer and activator of transcription 6
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04217  Necroptosis
dle04630  Jak-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle05161  Hepatitis B
dle05200  Pathways in cancer
dle05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    111173850 (STAT6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111173850 (STAT6)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111173850 (STAT6)
   04659 Th17 cell differentiation
    111173850 (STAT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111173850 (STAT6)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    111173850 (STAT6)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111173850 (STAT6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111173850 (STAT6)
Transcription factors [BR:dle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    111173850 (STAT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT6_C STAT_bind STAT_int STAT_alpha SH2
Motif
Other DBs
NCBI-GeneID: 111173850
NCBI-ProteinID: XP_022427495
UniProt: A0A2Y9N001
LinkDB All DBs
Position
Unknown
AA seq 847 aa AA seqDB search
MSLWGLVSKMPPEKLQRLYVDFPQHLRHLLGDWLENQPWEFLVGSDAFCCNMASALLSAT
VQCLQASAGEQGEGSTILQHISTLESIYQRDPLKLVATFRHILQGEKKAIMEQFRHLPMP
FHWKQEELKFNTVLRRLQHRVGETCLLRKALQPGAEGGQVSLHSLIETPANGTGPSEALA
TFLQETVGELEAAQALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
EVGAAGGELEPKTRAALLSRLDEVLRTLITSSFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLAAPAKPLMVRADMVTEKQARELSMPQGPGAGVESTGEIINNTVPLENSIPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSTSFTLSPNKLPIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFTDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLTTPE
AQTPTMMPSYDLGMVPDCSMNMQLGPDMAPQGYPPRSHSIPSYPALPREESVNVLPAFQE
PHLQMPPSLSQMGLPFDQPHPQGLLPCQPQEHAVSSSKPLLCSDVTMAEDSCLRQPVGGF
PQGTWVREDMLPPLLPPTEQDLTKLLLEGQGESEGGSLGAQPLLQPSCYGQSGISMSHLD
IRANPTW
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgtggggtctggtctccaaaatgcccccagaaaaactgcagcggctctatgtt
gacttccctcaacacctgcggcatctcctgggtgactggctggagaaccagccctgggaa
ttccttgtcggctcagacgccttctgctgcaacatggccagcgccctactttctgccact
gtccagtgtcttcaggcctcagctggagaacagggggaggggagcaccatcctgcaacac
atcagcaccctggagagcatatatcagagggaccccctgaagctggtggccactttcaga
cacatacttcaaggggaaaaaaaagccattatggaacagttccgccacctgccaatgccc
ttccactggaagcaagaggaactcaagtttaacacagtcctgcggaggctgcagcaccga
gtgggggagacctgccttctccgcaaagccctgcagcctggggctgagggaggccaagtg
tctttgcacagcctgatagaaactcctgccaatgggaccgggccaagtgaggccctcgcc
acgttcctgcaggagactgtcggggagctggaggctgcccaggccctggtgctgaagagg
atccagatttggaaacggcagcagcagctggcagggaatggcgcaccctttgaggagagc
ctggccccactacaggagaggtgtgagagcctggtggacatttactcccagctgcagcag
gaggtgggggcggctggtggagagcttgagcccaagacccgggcagcgctgcttagccgg
ctggatgaagtcctgcgaaccctcatcaccagctctttcctggtggaaaagcagcccccc
caggttctgaagactcagaccaagttccaggccggggttcgattcctgctgggcctgcgg
ttcctggcggccccagccaagcctctgatggtcagggccgacatggtaaccgagaagcag
gcgagggagctgagcatgccccaggggcccggggctggagtagaaagcactggggaaatc
attaacaacaccgtgcccctggagaacagcattcccgggaattgctgctctgccctgttc
aagaacctgcttctcaagaaaatcaagcggtgtgaacggaagggcacagagtctgtcacc
gaggagaagtgtgccgtgctcttttccaccagcttcacgctcagccccaacaaactccct
atccagctccaggccctgtctctgcccctggtggtcatcgtccacggcaaccaagacaac
aatgccaaagccaccattctgtgggacaacgccttctctgagatggaccgcgtgcccttt
gtggtggctgagcgggtgccctgggagaagatgtgtgaaactcttaacctcaagttcatg
gctgaggtggggaccaaccgggggttactcccagagcacttcctcttcctggcccagaag
atcttcaccgacaacagcctcagcatggaggccttccagcaccgttctgtgtcctggtca
cagttcaacaaggagatcctgctgggtcgtggcttcaccttttggcagtggtttgatggc
gtcctggacctcaccaaacgctgtctccggagctactggtcagatcggttgatcattggc
ttcatcagcaaacaatacgtcactagccttcttctcaacgagcctgatggaacattcctc
cttcggttcagtgactcagagattgggggcatcaccattgcccatgtcatccggggccag
gatggctccccacagatagagaacatccagccattctctgccaaagacctgtccattcgc
tcacttggtgaccgaatccgggacctcgctcagctcaaaaacctctaccccaagaaaccc
aaggacgaggctttccggagccactacaagcctgagcagatgggtaaggacggcaggggt
tatgtcccagctacaatcaagatgactgtggagagggaccagccacttaccacccctgag
gcccaaacgcctaccatgatgccctcttacgatcttggaatggtccctgactgctccatg
aacatgcagctcggcccagatatggcgccccaggggtacccaccacgctctcactccatc
ccctcatatccagcccttccccgggaagaatcggtcaatgtgctgccagccttccaggaa
cctcacctgcagatgccgcccagcctgagtcagatgggcctgccctttgaccaacctcac
ccgcagggcctgctgccgtgccagcctcaggagcatgccgtgtccagctccaagcccttg
ctctgctcagatgtgaccatggcggaagacagctgcctgaggcagccggtgggagggttc
cctcaaggcacctgggtccgtgaagacatgctcccgcccttgctgcctcccactgaacag
gacctcaccaagcttctcctggaggggcaaggagagtcagagggagggtccttgggagcc
caacccctcctgcagccctcctgctatgggcagtctgggatctcaatgtcccacctggac
ataagggctaaccccacttggtga

DBGET integrated database retrieval system