KEGG   Delphinapterus leucas (beluga whale): 111173869
Entry
111173869         CDS       T05885                                 

Gene name
STAT2
Definition
(RefSeq) signal transducer and activator of transcription 2 isoform X1
  KO
K11221  signal transducer and activator of transcription 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04062  Chemokine signaling pathway
dle04217  Necroptosis
dle04380  Osteoclast differentiation
dle04621  NOD-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111173869 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111173869 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111173869 (STAT2)
   04625 C-type lectin receptor signaling pathway
    111173869 (STAT2)
   04062 Chemokine signaling pathway
    111173869 (STAT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111173869 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111173869 (STAT2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111173869 (STAT2)
   05160 Hepatitis C
    111173869 (STAT2)
   05171 Coronavirus disease - COVID-19
    111173869 (STAT2)
   05164 Influenza A
    111173869 (STAT2)
   05162 Measles
    111173869 (STAT2)
   05168 Herpes simplex virus 1 infection
    111173869 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111173869 (STAT2)
   05169 Epstein-Barr virus infection
    111173869 (STAT2)
   05165 Human papillomavirus infection
    111173869 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111173869 (STAT2)
Transcription factors [BR:dle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    111173869 (STAT2)
SSDB
Motif
Pfam: STAT_alpha STAT2_C STAT_bind STAT_int SH2 CorA
Other DBs
NCBI-GeneID: 111173869
NCBI-ProteinID: XP_022427543
UniProt: A0A2Y9MYK6
LinkDB
Position
Unknown
AA seq 911 aa
MAQWEMLQNLDSPFQDQLHQLYSNSLLPVDIRQNLSVWIEDQNWQEAALGNDEAKANMLF
FHFLDQLNYECSRCSQDPECLLLQHNLRKFYRDIQAFPQGATQLAEMIFNLLLEEKRILT
QAQRAQLEQGEPALAAPGESQQHEIESRILELKAMMEKLVKSISQLKDQQDVFCFRYKIQ
TSARTPSLDPHQTRQQDILQETLNELDRRRKEVLDASKALLGRLTTLIELLLPKLEEWKV
QQQKACIGGPPDGGLEQLEKWFTAGAKLLFHLRQLLKELKGLSHMVTYQGDPLIEGVDLR
KAQVTELLLRLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRLQEGNESLTAE
VSIDRNPPESQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLMEQRSGSSGKGSNKG
LLAVTEELHIISFTVRYTYQGLKQELKTDTLPVVIISNMNQLSIAWASVLWFNLLSSDPQ
NQQFFSSPAKAPWDLLGPALSWQFSSYVGRGLDSDQLGMLRDKLFGQNSKTEGALLSWVN
FIKRESPPGKLPFWTWLDKILDLVHDHLKDLWNDGHIMGFVSRSQERRLLKKTISGTFLL
RFSETLEGGITCSWVEHQDDDKVLIYSVQPFTKEVLQSLPLAKIISQYQLLTEENIPENP
LCFLYPRIPRDEAFGCYSQEKVNLQERKKYLKHKLIVVSNRQVDELQQLPELKLEPELES
FELDLGLAPGPEPGPGLDLEPLLEAGLDLGPALESTLEPTLEPVMESTLEPVLESTLEPV
LESTLESVLESTLEPVLESTLEPTLESTLEPVLEPTLGEVSQRVPEPDLGPGLKLEPIPE
PISQPLPEPDLPHDLRHLNTEDMEIFRNSMKIEEIMPNGDPLLAGQNTMDEAYVFPRSHF
YTDGPLIPSDY
NT seq 2736 nt   +upstreamnt  +downstreamnt
atggcgcagtgggagatgctgcagaatcttgacagcccatttcaggatcagctgcaccag
ctctattcaaatagcctcctgccggtggacattcgacagaacttgtctgtctggattgaa
gatcagaactggcaggaagctgcactgggcaatgatgaggccaaggctaatatgctgttc
ttccacttcttggaccaactgaactatgagtgtagccgctgcagccaggaccctgagtgt
ttgttgctacagcacaacttgcgaaaattctatcgggacattcaggcctttccccagggt
gctacccaattggctgagatgatctttaatctccttctggaagaaaaaagaattctgacc
caggctcagagggctcagttggagcaaggagaaccagcccttgcagcacctggggagagc
cagcagcatgagattgaatcccggatcctggaattaaaggctatgatggagaagctggtg
aaatccatcagccaactgaaagaccagcaggatgtcttctgcttccgatataagatccag
acctcagcaaggacaccctctttggacccccatcagaccagacagcaggacattctgcag
gaaacgctcaatgaactggacagaaggagaaaggaggtgctagatgcctccaaagcactg
ctaggccgattaactaccctaattgagctactgctgcccaagttggaggagtggaaagtt
cagcagcagaaagcctgcattggaggtcccccggatggagggttggagcagttggagaag
tggttcacagctggagcaaagctgttgtttcatctgcggcagctgctgaaggagctaaag
ggattgagtcacatggtcacctatcagggggaccctctgatcgaaggggtggatctgcgg
aaggcccaggtcacagagctgctacttcgcctgctccacagagcctttgtagtagaaacc
cagccctgcatgccccaaactccccatcgacccctcatcctcaagactgggagcaagttc
accgtccgaacaaggctgctggtgagactccaggaaggcaatgagtcactgactgcagaa
gtctccattgacagaaatcctcctgaatcacaaggcttccggaagttcaacattctgacc
tcaaaccagaaaactttgactcctgagaaagggcagagtcagggcttaatttgggacttc
ggctacctgacactgatggagcagcgttcaggtagttcaggaaagggcagcaataagggg
ctgctagccgtgacagaggaactgcacattatcagcttcacagtcagatacacctaccag
ggtctgaagcaggaactgaaaacagacacccttcctgtggtgattatttctaacatgaac
caactctcaatcgcctgggcctcggttctctggttcaatctgctcagctcagacccccag
aatcagcagttcttctccagccccgccaaggccccctgggacttgctgggccctgctctc
agttggcagttctcctcctacgttggccgaggcctcgactcagaccagcttggcatgctg
cgggacaagctgtttgggcagaactccaagactgagggtgccttgttgtcctgggtcaat
ttcattaagcgagagagcccccctggcaagctaccattctggacatggctcgacaaaatt
ctggacctggtacatgaccacctgaaggatctctggaacgatggacacatcatgggcttt
gtaagccggagccaggagcgccggctgctgaagaagaccatctctggcacctttctgctg
cgcttcagtgaaacattggaagggggcattacctgctcctgggtggaacaccaagatgat
gataaggtgctcatctactctgtgcagcccttcaccaaggaggtgctgcagtcactcccg
ctggccaaaatcatcagccagtaccagctgctcactgaggagaacatacctgagaaccca
ctgtgcttcctctacccacgaatcccccgggatgaggcttttgggtgctattcccaggag
aaagttaatctccaggaacggaagaaatacctgaaacataagctcattgtggtctctaac
agacaggtggatgagctgcaacaactgccggagcttaagctagagccagaactggagtca
ttcgagctggatctggggctggcaccagggccagagccagggccgggcctggacttagag
ccactgctggaggcagggctggatttggggccagcactggagtccactctggagcccact
ctggagcccgtgatggagtctactctggagcccgtgctggagtccactctggagcctgtg
ctggagtccactctggagtctgtgctggagtccactctggagcctgtgctggagtccact
ctggagcccacactggagtccactctggagcccgtgctggagcccacactaggcgaggtg
tcacagagagtcccagagccagacctgggaccaggactgaagctggagcctattccagag
cctatttcacagccactgccagagccggatttgccccatgatctgagacacttgaacact
gaggacatggaaatcttcagaaacagcatgaagattgaagaaatcatgccaaatggtgac
ccactgttggctggccagaacaccatggatgaagcttacgtcttccctcgcagccatttc
tacacagatgggcccttgattccttctgactactag

DBGET integrated database retrieval system