KEGG   Delphinapterus leucas (beluga whale): 111173887
Entry
111173887         CDS       T05885                                 

Gene name
ERBB3
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-3
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04020  Calcium signaling pathway
dle04151  PI3K-Akt signaling pathway
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111173887 (ERBB3)
   04012 ErbB signaling pathway
    111173887 (ERBB3)
   04020 Calcium signaling pathway
    111173887 (ERBB3)
   04151 PI3K-Akt signaling pathway
    111173887 (ERBB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111173887 (ERBB3)
   05205 Proteoglycans in cancer
    111173887 (ERBB3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111173887 (ERBB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111173887 (ERBB3)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111173887 (ERBB3)
Protein kinases [BR:dle01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   111173887 (ERBB3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like SKG6
Other DBs
NCBI-GeneID: 111173887
NCBI-ProteinID: XP_022427590
UniProt: A0A2Y9N080
LinkDB
Position
Unknown
AA seq 1338 aa
MRANGALQVLGFLLSLARGSEVGNSQAVCPGTLNGLSVTGDADNQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSALPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRFTQLTEILSGGVYIEKNDKLCHMDTVDWRDIVRDRDAEIVVKDNG
RTCPPCHEVCKGRCWGPGPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRLFNDSGACVRQCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKICEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLSVFRTVREVTGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGLRSLKEISAGRIYISANRQLCYHHSLNWTRLLRGPSEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPSQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHEAECFSCHPECQPMEGTTTCNGSGSDACAQCAHFRDGPHCVSSCPFGVLGAKGPI
YKYPDAQNECRPCHENCTQGCKGPELQDCLGQTLALISKTHLAMALTVVVGLAVIFLILG
STFLYWRGRRIQNKRAMRRYLERGESVEPLDPSEKANKVSARIFKETELKKLKVLGSGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLITQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLHSETKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGIPPGAEPPALTNKELEEVELEPELDLDLELEAEEE
NLATTLGSALSLPLGTLTRPRGSQSLVSPSSGYMPMNQGNLGEAAQKSAVRGCSERCHRP
ASLHPVPRGRLASESSEGHVTGSEAELQEKVSMCRSRSRSPRPRGDSAYHSQRHSLLTPV
TPQSPPGLEEEDVNGYVMPDAHLKGTSSREGTLSSVGLSSVLGTEEEDDDDEYEYMNRRR
KCSPSRPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLNPVPTMPNASTTPDEDYEYMN
RRRGGGGPGGDYAAMEACPAAEQGYEEMRAFQGPVHHGPQVHYARLKTLRSLEATDSAFD
NPDYWHSRLFPKANAQRT
NT seq 4017 nt   +upstreamnt  +downstreamnt
atgagagcgaacggggctctgcaggtgctgggcttcctcctcagcctggcccggggctcc
gaggtgggcaactcgcaggcagtgtgccctgggactctgaatgggctgagtgtgaccggc
gatgccgacaaccagtaccagacactgtacaagctctacgagaggtgtgaggtggtgatg
gggaacctggagatcgtgctcacaggacacaatgctgacctctccttcctgcagtggatc
cgagaagtgaccggctacgtccttgtggccatgaatgagttctctgcgctgccactgccc
aacctccgagtggtgcgggggacccaggtctacgatgggaagtttgccatctttgtcatg
ttgaactacaacaccaactccagccatgctctgcgccagctccgctttactcagctcact
gagattctgtcagggggcgtttacattgagaagaatgataaactttgtcacatggacaca
gttgactggagggacatcgtgcgggaccgagacgccgagatagtggtgaaggacaatggc
aggacctgtcccccctgtcatgaggtctgcaaggggcgatgctggggtcctggaccagaa
gactgccagacactgaccaagaccatatgtgcccctcagtgtaatggtcactgctttggg
ccgaaccccaaccagtgctgccacgacgagtgtgcagggggctgctcgggccctcaggac
acagactgctttgcctgccggctcttcaatgacagtggagcctgtgtacgccagtgtcca
cagcctcttgtctacaacaagctaactttccagctggaacccaatccccacaccaagtat
cagtatggaggagtttgtgtagccagctgtccccataactttgtggtggatcaaacatct
tgtgtcagggcttgtcctcctgacaaaatggaagtagataaaaatggactcaagatatgt
gaaccttgtgggggtctgtgccccaaagcttgtgaggggacgggctctgggagccgcttc
cagactgtggactcgagcaacattgatggatttgtgaactgcaccaagatcctgggcaac
ctggactttcttatcaccggcctcaatggagacccctggcacaagattcccgccctggac
cctgagaagctcagtgtcttccggacagtgcgggaggtcacaggttacctgaacatccag
tcctggcctccccacatgcacaacttcagtgtcttttccaacctgacgaccattgggggc
cgaagcctctacaaccggggcttctcactgttgatcatgaagaacttgaatgtaacatct
ctgggcctccgatccttgaaagaaattagtgctgggcgtatctacataagtgccaatcga
cagctctgctaccaccattctttgaactggaccaggctgcttcgggggccttcggaagag
agactggacatcaagcataatcggccccgcagagactgcgtggcagaaggcaaagtgtgt
gacccactgtgctcctctgggggatgctggggcccaggccccagtcagtgcctatcttgc
cgaaactacagccgaggaggtgtctgtgtgacccactgcaactttctgaatggggagcct
cgtgagtttgcccacgaagctgaatgcttttcctgccacccggaatgccaacccatggag
ggcactaccacgtgcaatggctcgggctctgatgcttgtgcccagtgtgcccattttcga
gatgggccccactgtgtgagcagctgcccctttggagtcctcggtgccaagggccccatc
tacaagtacccagatgctcagaatgaatgtcggccctgtcatgagaactgcacccagggg
tgtaagggaccagagctacaagactgtttaggccaaacactggcactgatcagcaaaacc
catctggcaatggctttaacagtggtggtaggattggcagtgattttcctgatcctgggc
agcacttttctctattggcgtgggcgccggattcagaataagagggctatgaggcgctac
ttggaacggggtgagagcgtagagcccctggaccccagtgagaaggctaacaaagtctcg
gccagaatcttcaaggaaacagagctgaagaagcttaaagtgctgggctcgggcgtcttc
ggaactgtgcacaaaggagtgtggattcctgagggtgaatcgatcaagattccagtctgc
attaaagtcattgaggacaagagtggacggcaaagttttcaagctgtgacggaccacatg
ctggccattggcagcctcgaccatgcccacattgtacggctgctgggactgtgcccaggg
tcatctctgcagctcatcactcagtacctgcctctgggctccctgctggatcatgtgaga
caacaccgtggggcactggggccacagctgctgctcaactggggagtacaaattgccaag
ggaatgtactaccttgaggaacatggtatggtgcacaggaacctggctgcccgaaatgtg
ctactgaaatcacctagtcaagttcaggtggcagattttggggttgctgacttgctgccc
cctgatgataagcagctactgcacagtgagaccaagactccaattaagtggatggccctc
gagagtatccactttgggaaatacacacaccagagtgacgtctggagctatggagtgaca
gtttgggagctgatgacctttggggcagagccctatgcagggctgcgactggctgaagta
ccagatctgctggagaagggggagcggttggcacagccccagatctgtaccattgacgtc
tacatggtcatggtcaagtgttggatgattgatgagaacattcgcccaacctttaaagaa
ctagccaatgagttcaccaggatggcccgagacccaccacggtacctggtcataaagaga
gagagtgggcctggaattccgcctggggcagagccccctgctctaacaaacaaggaactg
gaggaagtagagctggagccagaactagacctagacctggagttggaggcagaggaggag
aacttggcaaccacactaggctctgcccttagcctgccacttggaacacttactcggcca
cgtgggagccagagccttgtaagtccatcatcgggatatatgcctatgaaccaggggaat
cttggggaggctgcccagaagtctgcagttcgtggctgtagtgaacggtgccaccgtcca
gcctctctgcacccagtgccacggggacgcctggcatcagagtcatcggagggccatgtg
acaggctctgaggccgagctccaggagaaggtatccatgtgtagaagccggagccggagc
ccacggccacgaggagacagtgcctaccattcccagcgccacagcctgcttactcctgtc
accccacagtccccaccagggttagaggaagaggatgtcaatggttatgtcatgccagat
gcacacctcaaaggtacctcctcccgggaaggcaccctttcttcagtgggtctcagttct
gtcctgggtactgaagaagaagatgacgacgacgagtatgaatacatgaaccggaggaga
aagtgcagtccatctcgtccccctaggccaagttcccttgaggagctgggttatgagtac
atggatgtgggatcagacctcagtgcttccctgggcagcacacagagttgcccgctcaac
cccgtgcccaccatgcccaacgccagcacaactccggatgaagattatgaatatatgaat
cggcgacgtggtggaggaggtcctgggggggattatgcagccatggaggcctgcccagca
gctgagcaagggtatgaagaaatgagagctttccaggggcctgtacaccatggcccccag
gtccattatgcccgcctcaaaactctacgtagtttagaagccactgactctgcctttgat
aaccccgattactggcatagccggcttttccccaaggctaatgcccagagaacataa

DBGET integrated database retrieval system