KEGG   Delphinapterus leucas (beluga whale): 111174232
Entry
111174232         CDS       T05885                                 

Gene name
FHIT
Definition
(RefSeq) bis(5'-adenosyl)-triphosphatase isoform X1
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00230  Purine metabolism
dle01100  Metabolic pathways
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111174232 (FHIT)
 09160 Human Diseases
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111174232 (FHIT)
   05223 Non-small cell lung cancer
    111174232 (FHIT)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     111174232 (FHIT)
SSDB
Motif
Pfam: HIT DcpS_C
Other DBs
NCBI-GeneID: 111174232
NCBI-ProteinID: XP_022428390
UniProt: A0A2Y9N2G6
LinkDB
Position
Unknown
AA seq 175 aa
MTHAPFSVVGIHGEAARSNRNSNREEMSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPG
HVLVCPLRPVERFRDLHPDEVADLFLAAQRVGTAVEKHFQGTSLTFSVQDGPEAGQTVKH
VHIHVLPRKAGDFGRNDSIYDELQKHDNEKEDSPALWRSEEEMAAEAAALRGYFQ
NT seq 528 nt   +upstreamnt  +downstreamnt
atgactcatgctccatttagtgtggtgggaatacatggagaagcagccagatccaaccga
aattcaaaccgtgaggaaatgtcattcagattcggccaacatctcatcaagccctctgtg
gtgtttctcaaaacagaactgtccttcgccctggtgaacaggaaacctgtggtacctgga
catgtcctcgtgtgtcccctccggccagtggagcgcttccgagacctgcatcccgatgaa
gtggccgacctgtttctggcagcacagagagtcgggacggcagtggaaaagcatttccag
ggcacctctctcaccttttccgtgcaggatggccccgaagccggacaaactgtgaagcat
gttcacatccacgttctcccaaggaaggctggagactttggcaggaatgacagcatctac
gatgagctccagaaacatgacaacgagaaggaggactccccagccttgtggagatcggaa
gaggagatggcagccgaagccgcggcgctgcgtggctactttcagtga

DBGET integrated database retrieval system