KEGG   Delphinapterus leucas (beluga whale): 111174359
Entry
111174359         CDS       T05885                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04014  Ras signaling pathway
dle04390  Hippo signaling pathway
dle04392  Hippo signaling pathway - multiple species
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05219  Bladder cancer
dle05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111174359 (RASSF1)
   04390 Hippo signaling pathway
    111174359 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    111174359 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111174359 (RASSF1)
   05206 MicroRNAs in cancer
    111174359 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    111174359 (RASSF1)
   05223 Non-small cell lung cancer
    111174359 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 111174359
NCBI-ProteinID: XP_022428747
UniProt: A0A2Y9NBD2
LinkDB
Position
Unknown
AA seq 340 aa
MSAEPELIELRDLAPARCAAPGRPRLERANALRIAPGTARNAARQLVPGRGHRFQPAGPT
THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPALERDTNVD
EPVEWETPDLSQAEIEQKIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPASK
KPPSLQDARRGPGRGTAVKRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPR
KFALFERAERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPE
LHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtccgctgagcctgagctcattgagctgcgggacctggcacccgcgcggtgcgccgcc
ccgggccgcccccggctcgagcgtgccaacgcgctgcgcatcgcgccgggcacagcgcgc
aacgccgcaaggcagctggtcccaggccgcggccaccgattccagcccgcggggcccact
acgcacacatggtgcgacctctgtggcgacttcatctggggcgtcgtgcgcaagggcctg
cagtgcgcacattgcaagttcacctgccactaccgttgccgcgcgctcgtctgcctagac
tgctgcggaccccgggacctgggctgggaaccggcgctggagcgggacacgaatgtggat
gagcccgtggagtgggagacacctgacctttctcaggctgagattgagcagaagatcaag
gagtacaatggccagatcaacagcaacttgttcatgagcctgaacaaggatggctcctac
acaggcttcatcaaggttcaactgaagctggtgcgccctgtctcagttcccgccagcaag
aagccaccctccttgcaggatgcccggcggggcccagggcggggtacagctgtgaaacgc
cgcacctccttctacctgcccaaggatgctgtcaagcacctgcatgtcttgtcacgcaca
cgggcacgcgaggtcatcgaggccctgctgcgcaagttcttggtggtggatgacccccgc
aagtttgcactttttgagcgggctgagcgccatggccaagtgtacctccggaagctgtca
gatgatgagcagcccctacggctacggctccttgcagggcccagtgagaaggccctaagc
tttgtcctgaaggagaatgactctggggaggtgaactgggatgctttcagcatgcctgag
ctacacaacttcctacgcatcctgcagcgggaggaagaggaacatctccgccagatcctg
cagaagtactcgtattgccgccagaagatccaggaagccctgcatgcctgccccctgggg
tga

DBGET integrated database retrieval system