KEGG   Delphinapterus leucas (beluga whale): 111174398
Entry
111174398         CDS       T05885                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04071  Sphingolipid signaling pathway
dle04072  Phospholipase D signaling pathway
dle04144  Endocytosis
dle04150  mTOR signaling pathway
dle04270  Vascular smooth muscle contraction
dle04310  Wnt signaling pathway
dle04350  TGF-beta signaling pathway
dle04360  Axon guidance
dle04510  Focal adhesion
dle04520  Adherens junction
dle04530  Tight junction
dle04611  Platelet activation
dle04621  NOD-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04660  T cell receptor signaling pathway
dle04670  Leukocyte transendothelial migration
dle04722  Neurotrophin signaling pathway
dle04810  Regulation of actin cytoskeleton
dle04921  Oxytocin signaling pathway
dle04928  Parathyroid hormone synthesis, secretion and action
dle04972  Pancreatic secretion
dle05100  Bacterial invasion of epithelial cells
dle05132  Salmonella infection
dle05133  Pertussis
dle05135  Yersinia infection
dle05152  Tuberculosis
dle05163  Human cytomegalovirus infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111174398 (RHOA)
   04015 Rap1 signaling pathway
    111174398 (RHOA)
   04310 Wnt signaling pathway
    111174398 (RHOA)
   04350 TGF-beta signaling pathway
    111174398 (RHOA)
   04072 Phospholipase D signaling pathway
    111174398 (RHOA)
   04071 Sphingolipid signaling pathway
    111174398 (RHOA)
   04024 cAMP signaling pathway
    111174398 (RHOA)
   04022 cGMP-PKG signaling pathway
    111174398 (RHOA)
   04150 mTOR signaling pathway
    111174398 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111174398 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111174398 (RHOA)
   04520 Adherens junction
    111174398 (RHOA)
   04530 Tight junction
    111174398 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111174398 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111174398 (RHOA)
   04621 NOD-like receptor signaling pathway
    111174398 (RHOA)
   04625 C-type lectin receptor signaling pathway
    111174398 (RHOA)
   04660 T cell receptor signaling pathway
    111174398 (RHOA)
   04670 Leukocyte transendothelial migration
    111174398 (RHOA)
   04062 Chemokine signaling pathway
    111174398 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111174398 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    111174398 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111174398 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    111174398 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111174398 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    111174398 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111174398 (RHOA)
   05206 MicroRNAs in cancer
    111174398 (RHOA)
   05205 Proteoglycans in cancer
    111174398 (RHOA)
   05203 Viral carcinogenesis
    111174398 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111174398 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111174398 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111174398 (RHOA)
   05135 Yersinia infection
    111174398 (RHOA)
   05133 Pertussis
    111174398 (RHOA)
   05152 Tuberculosis
    111174398 (RHOA)
   05100 Bacterial invasion of epithelial cells
    111174398 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111174398 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111174398 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111174398 (RHOA)
   04031 GTP-binding proteins [BR:dle04031]
    111174398 (RHOA)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    111174398 (RHOA)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111174398 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   111174398 (RHOA)
  Exosomal proteins of colorectal cancer cells
   111174398 (RHOA)
  Exosomal proteins of bladder cancer cells
   111174398 (RHOA)
GTP-binding proteins [BR:dle04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    111174398 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 111174398
NCBI-ProteinID: XP_022428856
UniProt: A0A2Y9NBP6
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggagatggagcctgtggcaagacttgc
ttgctcattgtctttagcaaggaccagttcccagaggtgtatgtacctacagtgtttgag
aactatgtggcagatattgaagtggacggaaagcaggtagagttggctttgtgggacaca
gctgggcaggaagattatgatcgcttgaggcctctctcctacccggatactgatgttata
ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact
ccagaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat
cttcgaaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccagtgaaa
ccggaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagcggctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system