Delphinapterus leucas (beluga whale): 111174398 Help Entry 111174398         CDS       T05885                                  Gene name RHOA Definition (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04014   Ras signaling pathway dle04015   Rap1 signaling pathway dle04022   cGMP-PKG signaling pathway dle04024   cAMP signaling pathway dle04062   Chemokine signaling pathway dle04071   Sphingolipid signaling pathway dle04072   Phospholipase D signaling pathway dle04144   Endocytosis dle04150   mTOR signaling pathway dle04270   Vascular smooth muscle contraction dle04310   Wnt signaling pathway dle04350   TGF-beta signaling pathway dle04360   Axon guidance dle04510   Focal adhesion dle04520   Adherens junction dle04530   Tight junction dle04611   Platelet activation dle04621   NOD-like receptor signaling pathway dle04625   C-type lectin receptor signaling pathway dle04660   T cell receptor signaling pathway dle04670   Leukocyte transendothelial migration dle04722   Neurotrophin signaling pathway dle04810   Regulation of actin cytoskeleton dle04921   Oxytocin signaling pathway dle04928   Parathyroid hormone synthesis, secretion and action dle04972   Pancreatic secretion dle05100   Bacterial invasion of epithelial cells dle05132   Salmonella infection dle05133   Pertussis dle05135   Yersinia infection dle05152   Tuberculosis dle05163   Human cytomegalovirus infection dle05200   Pathways in cancer dle05203   Viral carcinogenesis dle05205   Proteoglycans in cancer dle05206   MicroRNAs in cancer dle05210   Colorectal cancer dle05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     111174398 (RHOA)    04015 Rap1 signaling pathway     111174398 (RHOA)    04310 Wnt signaling pathway     111174398 (RHOA)    04350 TGF-beta signaling pathway     111174398 (RHOA)    04072 Phospholipase D signaling pathway     111174398 (RHOA)    04071 Sphingolipid signaling pathway     111174398 (RHOA)    04024 cAMP signaling pathway     111174398 (RHOA)    04022 cGMP-PKG signaling pathway     111174398 (RHOA)    04150 mTOR signaling pathway     111174398 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111174398 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     111174398 (RHOA)    04520 Adherens junction     111174398 (RHOA)    04530 Tight junction     111174398 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     111174398 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     111174398 (RHOA)    04621 NOD-like receptor signaling pathway     111174398 (RHOA)    04625 C-type lectin receptor signaling pathway     111174398 (RHOA)    04660 T cell receptor signaling pathway     111174398 (RHOA)    04670 Leukocyte transendothelial migration     111174398 (RHOA)    04062 Chemokine signaling pathway     111174398 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     111174398 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     111174398 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     111174398 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     111174398 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     111174398 (RHOA)   09158 Development and regeneration    04360 Axon guidance     111174398 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111174398 (RHOA)    05206 MicroRNAs in cancer     111174398 (RHOA)    05205 Proteoglycans in cancer     111174398 (RHOA)    05203 Viral carcinogenesis     111174398 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     111174398 (RHOA)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     111174398 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     111174398 (RHOA)    05135 Yersinia infection     111174398 (RHOA)    05133 Pertussis     111174398 (RHOA)    05152 Tuberculosis     111174398 (RHOA)    05100 Bacterial invasion of epithelial cells     111174398 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     111174398 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dle04131]     111174398 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dle04147]     111174398 (RHOA)    04031 GTP-binding proteins [BR:dle04031]     111174398 (RHOA) Membrane trafficking [BR:dle04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     111174398 (RHOA) Exosome [BR:dle04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111174398 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    111174398 (RHOA)   Exosomal proteins of colorectal cancer cells    111174398 (RHOA)   Exosomal proteins of bladder cancer cells    111174398 (RHOA) GTP-binding proteins [BR:dle04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     111174398 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  111174398 NCBI-ProteinID:  XP_022428856 UniProt:  A0A2Y9NBP6 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggagatggagcctgtggcaagacttgc ttgctcattgtctttagcaaggaccagttcccagaggtgtatgtacctacagtgtttgag aactatgtggcagatattgaagtggacggaaagcaggtagagttggctttgtgggacaca gctgggcaggaagattatgatcgcttgaggcctctctcctacccggatactgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccagaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcgaaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccagtgaaa ccggaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagcggctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system