KEGG   Delphinapterus leucas (beluga whale): 111174478
Entry
111174478         CDS       T05885                                 

Definition
(RefSeq) C-C chemokine receptor type 3
  KO
K04178  C-C chemokine receptor type 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04062  Chemokine signaling pathway
dle05163  Human cytomegalovirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111174478
   04061 Viral protein interaction with cytokine and cytokine receptor
    111174478
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    111174478
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111174478
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111174478
   05167 Kaposi sarcoma-associated herpesvirus infection
    111174478
G protein-coupled receptors [BR:dle04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    111174478
Cytokine receptors [BR:dle04050]
 Chemokine receptors
  CC Chemokine
   111174478
CD molecules [BR:dle04090]
 Proteins
  111174478
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF2417
Other DBs
NCBI-GeneID: 111174478
NCBI-ProteinID: XP_022429084
UniProt: A0A2Y9N323
LinkDB
Position
Unknown
AA seq 358 aa
MATSVDGTETVGEAAGTTPYDYEGALPCEKSNIKELGAQFLPPLYSLVFTVGLLGNVVVV
VILTKYNRLRIMTNIYLLNLAISDLLFLFTLPFWIHYVGWNEWVFGHHMCKLLSGLYYMG
LYSEIFFIILLTIDRYLAIVHAVFALRARTTTFGIITSIFTWGLAGLAALPEFIFHESQE
EFEQTFCSPLYPKNGENAWKCFHALRLNILGLALPLLVMAICYSGIIKTLLRCPSKKKYK
AIRLIFVIMVVFFIFWTPYNLVVLLSTFQVHLETECEQSRQLDLAMLVTEVIAYTHCCVN
PVIYAFVGERFQKHLRHFFHRHVAIYLGKFIPFLPSEKLERASSVSPSTGELELSAVF
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggcgacctcagtcgatgggactgagactgtgggtgaagctgctgggaccacaccctat
gactatgagggggcactgccatgtgaaaaaagcaacatcaaggagctgggggctcagttc
ctgcccccactgtattccctggtgttcacggttggtctgctgggcaatgtagtggtggtg
gtgatcctcacaaaatacaacaggctccggattatgaccaacatctacctgctcaatctg
gccatttccgacttgctcttcttattcactctgccgttctggattcactatgttgggtgg
aatgagtgggtttttggccaccatatgtgtaagttgctctccgggctctattacatgggc
ttgtatagtgagatcttcttcatcatactcctgaccatagaccggtatctggccatcgtt
cacgccgtgtttgcccttcgagcccggacgaccacttttggtatcatcaccagcatcttc
acctggggcctggcagggttagcagccctccctgaatttatcttccatgagtcccaagag
gagtttgaacagactttctgcagtcctctttacccaaagaatggagagaatgcctggaag
tgtttccatgctctgaggttgaatatcttgggtctcgctctgcctctgctcgttatggcc
atctgctactcaggaatcattaaaacactgctgagatgccccagtaaaaaaaaatacaag
gccatccggctcatttttgtcatcatggtggtcttctttattttctggacaccctacaat
ctggttgtcctcctctcaacttttcaagtgcacctggagactgagtgtgagcagagcaga
cagctggacctggccatgctggtgacggaggtgatcgcctacacccactgctgtgtcaac
cccgtgatctacgccttcgtcggtgagaggttccagaagcacctccgccactttttccac
aggcatgtggccatctacctgggcaaattcatcccatttcttcctagtgaaaaactggaa
agagccagctctgtctccccgtcaacaggggagctggaactctctgctgtattttag

DBGET integrated database retrieval system