KEGG   Delphinapterus leucas (beluga whale): 111174480
Entry
111174480         CDS       T05885                                 

Definition
(RefSeq) C-C chemokine receptor type 5
  KO
K04180  C-C chemokine receptor type 5
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04062  Chemokine signaling pathway
dle04144  Endocytosis
dle05145  Toxoplasmosis
dle05163  Human cytomegalovirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05170  Human immunodeficiency virus 1 infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111174480
   04061 Viral protein interaction with cytokine and cytokine receptor
    111174480
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111174480
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    111174480
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111174480
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111174480
   05163 Human cytomegalovirus infection
    111174480
   05167 Kaposi sarcoma-associated herpesvirus infection
    111174480
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111174480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dle04030]
    111174480
   04050 Cytokine receptors [BR:dle04050]
    111174480
   04090 CD molecules [BR:dle04090]
    111174480
G protein-coupled receptors [BR:dle04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    111174480
Cytokine receptors [BR:dle04050]
 Chemokine receptors
  CC Chemokine
   111174480
CD molecules [BR:dle04090]
 Proteins
  111174480
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 T4SS_pilin DUF1673 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 111174480
NCBI-ProteinID: XP_022429091
UniProt: A0A2Y9N7U9
LinkDB
Position
Unknown
AA seq 352 aa
MDYQTSSPLYDIDYGMSEPCQKVNVRQTAAQLLPLLYSLVFIFGFVGNILVVLILINCKK
LKSMTDIYLLNLAVSDLLFIITIPFWAHYAADQWVFGDITCQFFTGFYFIGFFSGIFFII
LLTIDRYLAIVHAVFALKARTVTSGVVTSGVTWVVAVLASLPGIIFTKSQKEGSRYTCSP
HFPSSQYHFWKNLRTLKIVILGLVLPLLVMIVCYSGILKTLLRCRNEKKRHKAVRLIFAV
MIVYFFFWAPYNIVLLLSTFQEFFGLNNCSDSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRSYLLQFFRKHVARCFCKGCPVFQGDAPERTSSVYTRSTGEQEISVGL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggattatcaaacatcaagtcccctctacgacattgattatgggatgtcagagccctgc
caaaaagtcaatgtgagacaaactgcagcccagctcctgcccctgctctactcgctggtg
ttcatctttggttttgtgggtaacattctggtcgtcctcatcctgatcaactgcaaaaag
ctgaaaagcatgactgacatctacctgctcaacttggccgtctccgacctgcttttcatc
atcaccatcccattctgggctcactatgctgcagaccagtgggtctttggagatataacg
tgccagtttttcacgggcttctatttcattggctttttctctggaatcttcttcatcatc
ctcttgacaattgataggtacctggctatcgtccatgctgtgtttgctttgaaagccagg
acagtcacctctggggtggtgacaagtggggtcacctgggtggtggctgtgcttgcctct
ctcccaggaatcatctttaccaaatcccagaaagagggttctcgttatacatgcagccct
cattttccatccagtcagtatcatttctggaagaatctccgaactttaaagatagtcatc
ttgggcctggtgctgccactacttgtcatgatcgtctgctactcgggaatcctaaaaacc
ctgcttcggtgtcgcaacgagaagaagaggcacaaggccgtgaggctcatctttgccgtc
atgattgtctactttttcttctgggctccctacaacatcgtccttcttctgagcaccttc
caggaattctttggcctgaataactgcagtgactctaacaggctggaccaagccatgcag
gtgacagagaccctggggatgacacactgctgcatcaaccccatcatctatgccttcgtc
ggggagaagttccgaagctatctcttacagttcttccgaaagcacgttgccagatgcttc
tgcaaaggctgtccagtcttccagggagatgctccagagagaacgagctccgtttacaca
cgatccacgggggagcaggaaatctctgttggcttgtga

DBGET integrated database retrieval system