Delphinapterus leucas (beluga whale): 111174575 Help Entry 111174575         CDS       T05885                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism dle  Delphinapterus leucas (beluga whale) Pathway dle00190   Oxidative phosphorylation dle01100   Metabolic pathways dle01524   Platinum drug resistance dle04115   p53 signaling pathway dle04210   Apoptosis dle04215   Apoptosis - multiple species dle04932   Non-alcoholic fatty liver disease dle05010   Alzheimer disease dle05012   Parkinson disease dle05014   Amyotrophic lateral sclerosis dle05016   Huntington disease dle05017   Spinocerebellar ataxia dle05020   Prion disease dle05022   Pathways of neurodegeneration - multiple diseases dle05132   Salmonella infection dle05134   Legionellosis dle05145   Toxoplasmosis dle05152   Tuberculosis dle05160   Hepatitis C dle05161   Hepatitis B dle05162   Measles dle05163   Human cytomegalovirus infection dle05164   Influenza A dle05167   Kaposi sarcoma-associated herpesvirus infection dle05168   Herpes simplex virus 1 infection dle05169   Epstein-Barr virus infection dle05170   Human immunodeficiency virus 1 infection dle05200   Pathways in cancer dle05210   Colorectal cancer dle05222   Small cell lung cancer dle05416   Viral myocarditis dle05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     111174575  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     111174575    04215 Apoptosis - multiple species     111174575    04115 p53 signaling pathway     111174575  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111174575   09162 Cancer: specific types    05210 Colorectal cancer     111174575    05222 Small cell lung cancer     111174575   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     111174575    05161 Hepatitis B     111174575    05160 Hepatitis C     111174575    05164 Influenza A     111174575    05162 Measles     111174575    05168 Herpes simplex virus 1 infection     111174575    05163 Human cytomegalovirus infection     111174575    05167 Kaposi sarcoma-associated herpesvirus infection     111174575    05169 Epstein-Barr virus infection     111174575   09171 Infectious disease: bacterial    05132 Salmonella infection     111174575    05134 Legionellosis     111174575    05152 Tuberculosis     111174575   09174 Infectious disease: parasitic    05145 Toxoplasmosis     111174575   09164 Neurodegenerative disease    05010 Alzheimer disease     111174575    05012 Parkinson disease     111174575    05014 Amyotrophic lateral sclerosis     111174575    05016 Huntington disease     111174575    05017 Spinocerebellar ataxia     111174575    05020 Prion disease     111174575    05022 Pathways of neurodegeneration - multiple diseases     111174575   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     111174575    05416 Viral myocarditis     111174575   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     111174575   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     111174575 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  111174575 NCBI-ProteinID:  XP_022429180 UniProt:  A0A2Y9N4M1 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MEKRGKHKTGPNLHGLFGQKTGQAPGFSYTDASKNKGISWGEETLMGYMENPKKYIPGTK MIFTGIRRG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaaaagagaggcaagcacaagactgggccaaatctccatggtctgtttgggcaaaag acaggtcaggcccctggattttcttacacagatgccagcaagaacaaaggcatctcttgg ggagaggagacactgatggggtatatggagaatcccaagaagtacatccctggaacaaaa atgattttcacaggcattagaaggggctga

DBGET integrated database retrieval system