KEGG   Delphinapterus leucas (beluga whale): 111174732
Entry
111174732         CDS       T05885                                 

Gene name
ALK
Definition
(RefSeq) ALK tyrosine kinase receptor
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle05200  Pathways in cancer
dle05223  Non-small cell lung cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111174732 (ALK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111174732 (ALK)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    111174732 (ALK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111174732 (ALK)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dle04090]
    111174732 (ALK)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111174732 (ALK)
Protein kinases [BR:dle01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   111174732 (ALK)
CD molecules [BR:dle04090]
 Proteins
  111174732 (ALK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase MAM Gly_rich Ldl_recept_a FXa_inhibition
Other DBs
NCBI-GeneID: 111174732
NCBI-ProteinID: XP_030618814
LinkDB
Position
Unknown
AA seq 1669 aa
MGSALQPREPLSYSRLQRKSLAVDFVVPSLFRVYARDLLLPPPSPSEPRAGRLEARGSLA
LDCAPLLRLVGPPPGASSPAPARAWTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVG
PPGEATAGLLQFNLTELFSWWIRHGEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLL
FQIFATGTGSRQSSLESPANLPSLPPDSFAWNLTWIMKDSFPFLSHRSRYGLECSFDFPC
ELEYSPPLHNLGNQSWSWRRVPPEEASQMDLLDGPEEEHAKEMPRGAFLLLNTSMNSRHS
ILSPWVRSSSEHCRLAVSVHRHLQPSGRYVARLLPHSEAGREIPLVPTPGKHGWTVLQGR
IGRPENPFRVALEYISSGNRSLSAVDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQLG
QACDFHRDCAQGEDEGQLCSKLPAGFYCNFEDGFCGWTQSSLSPHTPQWQVRTLKDARFQ
DHQGHALLLSTTDAPTSESATVTSAAFPAPMKSSPCELRMSWLIRGVLQGNVSLVLVENK
TGKEQSRMIWHVATTEGLSLWQWTALPLLDVADRFWLQIVAWWEQGSRATVAFNNISISL
DCYLTIGGEDKMPQTTAPKSRNLFEGNPNKETKPWENTPKENPIFDPTVHWLFTTCGASG
PHGPTQAQCNNAYRNSNLSVVVGSEGPLKGIQTWKVPATDTYSISGYGAAGGKGGKNTMM
RSHGVSVLGIFNLEKDDVLYILVGQQGEDACPSTNQLIQKVCIGENNVIEEEIRVNKSVH
EWAGGGGGGGGATYVFKMKDGVPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNG
NSGAAGGGGGWNDNTSLLWSGKSLLEGATGGHSCPQAVKKWGWETRGGFGGGGGGCSSGG
GGGGYIGCARVSRRGHPPLRSTLLWFATGGNAASNNDPEMDGEDGVSFINPLGILYTPAL
KGTPSARWQNQCAVDFPAQAALPAAMGRRSRNQKTHPDQLETERRAWGWGAGRLPPEADP
PSFSPVMEGHGEVNIKHYLNCSHCEVDECHLDPESHRVICFCDHGTVLAEDGVSCIVSPT
PEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTS
TIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQ
VAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILLELMAGGDLKS
FLRETRPRPNQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVA
KIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLG
YMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYC
TQDPDVINTALPIEYGPLVEEEEKVPMRPKDPEGIPPLLVSAPQAKREEGREPAARTALP
SASSGKAGKKSGAAEASARGARALAVKGGHVNMAFSQSNPPSELHQVQGSRNKPTSLWNP
TYGSWFTEKPTKKSNPPAKKEQRERGNPGGDGGRAIPPPAAAGHRPGTSLLLEPSSLTAS
LRDVPLFRLRHFPCGTVHYGYQQQGFPPEASAPGPGRYEDPAAKSQPAP
NT seq 5010 nt   +upstreamnt  +downstreamnt
atggggtcggcgctgcagccccgggagccgctcagctactcgcgcctgcagaggaagagc
ctggcggtggactttgtggtaccctctctctttcgcgtctatgctcgggacctgctgctg
ccgccgccgtccccttcggagccaagggccggccggctggaggcgcgcggctcgctggct
cttgactgcgccccactgcttaggctggtggggccaccacccggcgccagttctcccgcc
ccggcccgggcatggacgctgtccagggtgctgaagggaggctcggttcgcaagctccgg
cgcgccaagcagctggtgctggagctgggagaggaggcgatccttgagggctgtgtaggg
cccccaggggaggcgactgcggggctgctccagttcaacctcactgagctgttcagctgg
tggattcgccacggcgaaggacggctgaggatccgcctgatgcccgagaagaaggcgtcg
gaagtgggcagagagggaaggctgtccgctgcgatccgcgcctcccagccccgccttctc
ttccagatcttcgcgaccgggaccggttcccgtcagagctccttggagtcaccagcaaac
ctgccttctcttcctcctgattcttttgcctggaatctgacctggataatgaaagattcc
ttccctttcctgtctcatcgcagccgatatggtctggagtgcagctttgacttcccctgt
gagctggagtattcccctccactgcacaaccttgggaaccagagctggtcctggcgccgt
gtccctcccgaggaggcttcccagatggacctgttggatgggcccgaagaggagcatgcc
aaggagatgcccagaggtgccttcctcctcctcaacacctcgatgaactccaggcacagc
atcttgagtccatgggtgagaagcagcagcgagcactgcaggctggccgtctcggtacac
aggcacctgcagccctccgggaggtacgtcgcccggctgctgccccacagtgaggctgga
agagagatccccctggtacccactccaggaaagcatggttggactgtgcttcagggaaga
attgggcgcccagagaacccgttccgagtggccctggaatacatctcgagtggaaaccga
agcttgtctgcagtggacttctttgccctgaaaaactgcagcgaaggaacatccccgggc
tccaagatggccttgcagagttccttcacttgctggaacggaacagtcctccagctcgga
caggcctgcgacttccaccgcgactgtgcccagggagaagatgagggccagctgtgcagt
aaactccctgctggtttttactgcaacttcgaggatggattctgtggctggacccaaagc
tcactgtcaccccacacgccccagtggcaagtcaggaccttaaaggatgcccggttccag
gaccaccaaggccacgccctgttgctcagcaccaccgatgcccccacctctgaaagtgct
acggtgaccagcgctgcgttccccgcaccgatgaagagctctccatgcgagctccgaatg
tcctggctcatccgtggagtgctgcagggaaatgtctccttggtgctggtggagaacaaa
accgggaaggaacaaagcagaatgatctggcatgttgccaccacggaaggcttgagcctg
tggcagtggacggcgctgcctctccttgatgtggctgacaggttctggttgcagatcgtt
gcctggtgggaacaaggatccagagccaccgtggctttcaacaatatctccatcagcctg
gactgctacctcaccattggtggggaggacaagatgccgcagactacggcacccaagtca
agaaatctgtttgagggaaacccaaacaaggagacaaaaccctgggaaaacacaccaaaa
gagaaccccatctttgaccctacagttcactggctgttcaccacatgcggggccagtggg
ccccacggcccgacgcaggcccagtgcaacaatgcctaccggaactccaacctgagcgtg
gtggtggggagcgagggccccctgaagggcatccagacctggaaggtgccagccaccgac
acctacagcatatcaggctacggagccgctggcgggaaaggcgggaaaaacacgatgatg
cgatcccacggcgtgtctgtgctgggcatcttcaacctggagaaggacgacgtgctgtac
atcctggtcgggcagcagggggaagatgcctgccccagtacaaaccaactaatccagaaa
gtctgcattggagagaacaacgtgatagaagaagaaatccgcgtgaacaaaagtgtgcac
gagtgggcaggagggggcggcggagggggcggagccacctacgtatttaagatgaaggat
ggagtgccagtgcccctgatcattgcggccggcggtggcggcagggcctacggagccaag
acagacacgttccacccagagagactggagaataactcctcagttctagggctgaatggc
aattccggagccgcaggtggcggaggtggctggaatgataacacttccttgctctggtct
ggaaagtctttgctggaaggtgccaccggaggacattcctgcccccaggccgtgaagaag
tgggggtgggagaccagagggggtttcggagggggtggaggggggtgctcctcaggtgga
ggaggcggaggatatataggatgcgcacgtgtgtccagacgtgggcacccacctctgcgt
tcaactctcctctggtttgccacaggtggcaatgcagcctcaaacaatgaccccgagatg
gacggggaggatggggtttccttcatcaatccactgggcatcctgtacaccccggcttta
aaaggtaccccctctgccaggtggcagaaccaatgcgctgtggactttcctgcacaggca
gcgctcccggcggcaatgggacgtaggagcaggaaccagaaaacccaccctgaccagctg
gagacagagcgcagagcctgggggtggggtgcagggcggcttccgcccgaggctgaccct
ccctccttctcaccagtgatggagggccacggggaagtgaatattaagcattacctgaac
tgcagccactgtgaggtagatgagtgccacctggaccccgagagccacagggtcatctgc
ttctgcgaccacgggacagtgctggccgaggatggcgtctcctgcatagtgtcgcccacc
ccggagccccacctgccactctcgctgatcctgtccgtcgtgacctctgccctcgtggcc
gccctcgtcctggctttctccggcatcatgatcgtgtaccgccggaagcaccaggagctg
caagccatgcagatggagctgcagagccccgagtacaagctgagcaagctccgcacctcc
accatcatgaccgactacaaccccaactactgttttgccggcaaaacctcctccatcagt
gacctgaaggaggtgcccaggaaaaacatcaccctcatccggggtctgggccacggcgcg
tttggggaggtgtatgaaggtcaggtgtctggaatgcccaacgacccgagccccctgcaa
gtggctgtaaagacgctgcctgaggtgtgttccgaacaggacgaactggatttcctcatg
gaagccctgatcatcagcaagttcaaccaccagaacatcgtgcgctgtatcggggtgagt
ctgcaagccctgccccgatttatcctgctggagctcatggcgggaggagacctcaagtcc
ttcctccgagagacgcgccctcgcccgaatcagccctcctccctggccatgctggacctc
ctgcacgtggctcgggacatcgcctgtggctgccagtatctagaggaaaatcacttcatc
caccgggacattgctgccaggaactgcctcttgacctgtccaggccctggaagggtggcc
aagatcggagacttcggaatggctcgagacatctacagagcgagctactaccgaaaggga
ggctgtgcgatgctgccggtcaaatggatgcccccggaggccttcatggaaggaatattt
acttctaaaacagacacgtggtccttcggagtgcttctgtgggaaatcttctctcttgga
tacatgccgtaccctagcaaaagcaaccaggaggttctggagtttgtcaccagtggagga
cggatggacccacctaagaactgccccgggcctgtataccggataatgacccagtgctgg
caacatcagcctgaagacaggcccaactttgccataattttggagaggattgaatactgc
acccaggacccagatgtgatcaacactgctttgcccatagaatacgggcccctcgtggaa
gaggaagagaaggtgcccatgaggcccaaggaccctgagggaatccctcctctgctggtc
tccgctccccaggccaagcgggaggagggccgcgagccagccgcccgcacggctctgcct
tccgcctcctcgggcaaagccggcaagaagtccggggccgcagaggcctctgcccgaggc
gccagggcgctggccgtgaaggggggacacgttaacatggcattctctcagtccaacccg
ccctcggagctgcaccaagtccaggggtccagaaacaagcccaccagcctatggaaccca
acttacggctcctggtttacagagaaacccaccaaaaagagcaatcctccggcgaagaag
gagcagcgcgagagggggaacccgggcggcgacggcggccgtgccatcccgccccccgcg
gctgccggccaccgtccaggcacctctctgctcctcgagccgtcctcgctgaccgccagc
ctgagggacgtgcccctgttcaggctgcgccacttcccgtgcggcaccgtccactacggc
taccagcagcagggcttccccccggaggcctccgccccgggcccgggtcgctacgaggac
cccgcggccaagagccagcctgcgccctga

KEGG   Delphinapterus leucas (beluga whale): 111174834
Entry
111174834         CDS       T05885                                 

Gene name
EML4
Definition
(RefSeq) echinoderm microtubule-associated protein-like 4 isoform X1
  KO
K15420  echinoderm microtubule-associated protein-like 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle05200  Pathways in cancer
dle05223  Non-small cell lung cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111174834 (EML4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111174834 (EML4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    111174834 (EML4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dle04812]
    111174834 (EML4)
Cytoskeleton proteins [BR:dle04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EMAP
     111174834 (EML4)
SSDB
Motif
Pfam: HELP WD40 ANAPC4_WD40 Ribosomal_S7 SlyX
Other DBs
NCBI-GeneID: 111174834
NCBI-ProteinID: XP_022429682
UniProt: A0A2Y9NDZ3
LinkDB
Position
Unknown
AA seq 992 aa
MDGFAGSLDDSISAASTSDVQDRLSALELRVQQQEDEITVLKAALADVLRRLTISEDHVA
SVKKSVPSKGQPGIREAISMSCITNGSGANRKPSHTSSVSIARKETLSSAAKSGTEKKKE
KPQGQREKKEESHSNDQSPQIRASPSPQPSSQPLQIHRQTQESKNSTPTKSIKRPPTAEK
SHNSWENSDDSRNKLLRAVSTSKLISKVIKNADKHKDVIINQAKMSTREKNSQEGEYVKM
FMRGRPITMFIPSDVDNYDDIRTELPPEKLKLEWVYGYRGKDCRANVYLLPTGEIVYFIA
SVVVLFNYEERTQRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSV
SLSTLQIIGLGTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKSKGAEIKTTN
EVVLAVEFHPTDANTIITCGKSHIFFWTWSGNSLTRKQGVFGKYEKPKFVQCLTFLGNGD
VLTGDSGGVILIWSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGK
DRKIILWDHDLNPEREIEVPDQYGTIRAVAEGKADQFLVGTSRNFILRGTFNDGFQIEVQ
GHTDELWGLATHPFKDLLLTCAQDRQVCMWNSVEHRLEWTRLVDEPGHCADFHPSGTVVA
IGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSLDGTFLAVGSHDNFIYLYVVSENGR
KYSRHGKCTGHSSYITHLDWSPDNKYIMSNSGDYEILYWDIPNGCKLIRNRSDCKDIDWT
TYTCVLGFQVFGVWPEGSDGTDINALVRSHNRKVIAVADDFCKVHLFQYPCSKAKAPSHK
YSAHSSHVTNVSFTHNDSHLISTGGKDMSIIQWKLVEKLSLPQNEVVADTALTKAPISSI
ESVVQPDAPTPPPSQPLNETAEEESRISSSPTLLENSLEQTVGPSEDHSEEQSEGGSEDL
GEPVYEEPAHEMSDEQSEGALPGDQQDPSPLS
NT seq 2979 nt   +upstreamnt  +downstreamnt
atggacggtttcgccggcagcctcgatgatagtatttctgctgcaagtacttctgatgtt
caagatcgcctctcagcccttgagttacgagttcaacaacaagaagatgaaatcactgtg
ctaaaggcagctttggctgatgttttgaggcgtcttacaatctctgaagatcatgtagcc
tcagtgaaaaaatcagtcccaagtaaaggccagccaggcatccgagaagctatttccatg
tcctgtataaccaatgggagtggtgcaaacagaaaaccaagtcacaccagctctgtttca
attgcaagaaaagaaactctttcatctgctgctaaaagtggtacagaaaaaaagaaagaa
aaaccacaaggacagagagaaaaaaaagaggaatctcactctaatgatcaaagtccacaa
attcgagcatcaccttctccccagccctcttcacagcctctccaaatacacagacaaact
caagaaagcaagaattctactcccaccaaaagcataaaacgaccaccaacagctgaaaag
tcacataattcatgggaaaattcagacgatagccgtaataaattactgagggcagtttca
acatcaaaattaatatcaaaagttataaaaaatgcagacaagcataaagatgtcatcatc
aaccaagcaaaaatgtcaacccgtgaaaaaaacagccaagaaggagaatatgttaaaatg
tttatgcgaggtcgaccaattacaatgttcattccttctgatgttgacaactatgatgac
atcagaacagagctgcctcctgagaagctcaaactggagtgggtatatggttatcgagga
aaggactgtcgagctaatgtttaccttcttcctaccggggaaatcgtttatttcatagca
tcagtagtagtactatttaattatgaggagagaactcaacgacactacctgggtcataca
gactgtgtgaaatgccttgctatacatcctgacaaaattaggattgcaactggacagata
gctggagtggataaggatggaaggcccctgcaaccccatgtcagagtgtgggattcagtt
agtctatctacactgcaaattattggacttggaacttttgagcgtggagtaggatgcctg
gatttttcaaaagcagattcaggtgttcatttatgtgttattgatgactccaatgagcat
atgcttactgtatgggattggcagaagaaatcaaaaggagcagaaataaagacaacaaat
gaagttgttttggctgtggaattccatccaacagatgcaaataccataataacctgtggt
aaatctcacatttttttctggacctggagtggcaattcactaacaagaaaacagggagtt
tttgggaaatatgaaaaaccaaaatttgtgcagtgtttgacattcttggggaatggagat
gttcttactggagactcaggtggagtcatacttatatggagcaaaactactgtagaaccc
acacctgggaaagggcctaaaggtgtttatcagatcagcaaacaaatcaaagctcatgat
ggcagtgtgttcacactttgtcagatgagaaatggtatgttattaactggaggcgggaaa
gacagaaaaataattctgtgggatcatgatctgaatcctgaaagagaaatagaggttcct
gatcagtatggaacaatcagagctgtagcagaaggaaaggcagatcaatttttggtaggc
acatcacgaaactttattttacggggaacgtttaatgatggcttccaaatagaagtacag
ggtcatactgatgagctttggggtcttgccacacatcccttcaaagatttgctcttgaca
tgtgctcaggacagacaggtgtgcatgtggaactcggtggaacacaggctggaatggacc
aggctcgtagatgaaccaggacactgtgcagattttcatccaagtggcacagtggtggcc
ataggaacgcactcaggcaggtggtttgttctggatgcagaaaccagagatctagtttct
atccacacagacgggaatgaacagctctctgtgatgcgctactcattagatggcaccttc
ctggctgtgggatctcatgacaactttatttacctctatgtagtctcagaaaatggaaga
aagtatagcagacatggaaagtgcactggacattccagctatatcacacaccttgactgg
tctccagacaacaagtacataatgtctaactcgggagactatgagattctgtactgggac
attccaaatggctgcaaactaatcaggaatcgatcagattgtaaggacatcgattggaca
acatacacctgtgtgctaggctttcaagtctttggtgtctggccagaaggatctgatggg
acagatatcaatgcactggtgcgatcccacaatagaaaggtgatagctgttgctgatgac
ttttgcaaagtccacctgtttcagtatccctgctccaaagcaaaggctcccagtcacaag
tacagtgcccacagcagccatgtcaccaatgtcagttttactcataatgacagtcacctg
atttcaactggtggaaaagacatgagcatcattcagtggaaacttgtggaaaagttatct
ttgcctcaaaatgaggttgtagcagatactgcgctcaccaaagcccccatctcttccatt
gaaagtgtcgtgcagcccgatgctcccacaccacctccttcccagcccttaaatgagaca
gctgaagaagaaagcaggataagcagttctcccacacttctggagaacagcctggaacag
actgtggggcccagcgaagaccacagtgaggagcagagtgaggggggcagcgaagacctc
ggtgagcctgtttatgaagagccagcccatgagatgagtgatgagcagagcgaaggcgct
cttcccggggaccagcaagacccttcacccctgtcctaa

DBGET integrated database retrieval system