KEGG   Delphinapterus leucas (beluga whale): 111174878
Entry
111174878         CDS       T05885                                 

Gene name
EIF2AK2
Definition
(RefSeq) interferon-induced, double-stranded RNA-activated protein kinase isoform X1
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04141  Protein processing in endoplasmic reticulum
dle04217  Necroptosis
dle05010  Alzheimer disease
dle05160  Hepatitis C
dle05162  Measles
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111174878 (EIF2AK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111174878 (EIF2AK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111174878 (EIF2AK2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111174878 (EIF2AK2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111174878 (EIF2AK2)
   05171 Coronavirus disease - COVID-19
    111174878 (EIF2AK2)
   05164 Influenza A
    111174878 (EIF2AK2)
   05162 Measles
    111174878 (EIF2AK2)
   05168 Herpes simplex virus 1 infection
    111174878 (EIF2AK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111174878 (EIF2AK2)
   05169 Epstein-Barr virus infection
    111174878 (EIF2AK2)
   05165 Human papillomavirus infection
    111174878 (EIF2AK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111174878 (EIF2AK2)
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111174878 (EIF2AK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dle03019]
    111174878 (EIF2AK2)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111174878 (EIF2AK2)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   111174878 (EIF2AK2)
Protein phosphatases and associated proteins [BR:dle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111174878 (EIF2AK2)
Messenger RNA biogenesis [BR:dle03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     111174878 (EIF2AK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr dsrm DND1_DSRM Kinase-like APH ABC1
Other DBs
NCBI-GeneID: 111174878
NCBI-ProteinID: XP_022429780
UniProt: A0A2Y9NA31
LinkDB
Position
Unknown
AA seq 539 aa
MASGRSPCFYIEELNKYQQKNTAVLKYRELSKTGPPHNLRFTYQVIIDGKEFPKAEGRSK
KEAKNAAAKLAFEIISKEQKAASPSSLQTGDPSEVPPIENYIGRVNTIAQKKNLSVIYEE
CESRDSGPDKFHYKCKIGQNEYGIGVGSTKQEARQLAAKVAYEEIQSENLMKADASSGCF
INVCGDVQSNSSATNTSASESQSENDFSTSEAESNDNSDALDKSFQSPENSSRNNPRKVK
RSLAPRFDSPVKREESMYTVDSRFSRDFTEVTPIDAGGFGQVFKAKHKIDEKTYVIKRVK
YNNEKVEREVKALAMLDHANIVHYHSCWDGLDYDPEQSINSSRSKTRCLFIQMEYCDKGT
LERWIDSRRGKKQDKCLALVFFEQITEGVHYIHSKQLIHRDLKPGNIFLVGMNQIKIGDF
GLVTYLKNDDARTSKQGTMRYMSPEQISCMEDYGNEVDIFALGLILAELLHICSTVSETV
KLFEDLRDGTFSDVFDNKEKNLLQKLLSNDPKKRPNTLEILKTLKEWNNIAEKKKWNTC
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggccagtggtcgttcaccatgtttctatatagaagaacttaataagtaccaacaaaag
aacactgcagtacttaagtatcgtgaactgtctaagacaggacctccacataacttaagg
tttacctatcaagtcataatagatggcaaagaatttccaaaggctgaaggtagatcaaaa
aaggaagccaaaaatgctgcagccaaattagcttttgaaataattagtaaagaacagaag
gccgctagtccttcatcactgcagacaggagatccttcagaagtaccacccattgagaat
tacataggccgtgttaatacgattgcccagaagaaaaacctatctgtaatttatgaagaa
tgtgaatcgagggacagtgggcccgataaatttcattataaatgcaaaattggacagaat
gaatatggtattggtgtaggttccactaaacaggaggcaagacagttggctgctaaagtg
gcttatgaagagatacagtcagaaaatttaatgaaagctgacgcatcctctggttgtttc
attaatgtgtgtggtgatgtccaaagcaactcttcagcgacaaacacatctgcttctgaa
tcacaatctgaaaatgacttctcaacaagtgaagcggaaagcaatgataacagtgacgca
ttagacaagtctttccaatctccagagaacagttccagaaataatcccagaaaggtgaag
agatctttggcacctagatttgactctcctgtgaagagggaagaaagcatgtatactgtg
gactccaggtttagcagagattttacagaagtaacaccaattgacgcaggtggatttggc
caagttttcaaagccaaacacaaaattgatgagaagacttatgttattaaacgtgttaaa
tataataacgagaaggtagagcgtgaagtgaaagctttggcaatgcttgatcatgcaaat
atcgttcactaccacagctgttgggatgggcttgattacgatcctgagcaaagcataaat
tcttcaagatcaaagactaggtgccttttcatccaaatggaatactgtgataaagggaca
ttggagcgatggattgacagtagaagaggcaagaaacaagacaaatgtttggctttggta
ttctttgaacaaataacagaaggagtgcattacatacattcaaaacagttaattcataga
gaccttaagccaggtaatatatttttagtaggtatgaaccaaataaagattggagacttt
ggacttgtaacatacctgaaaaatgatgacgcacggacaagtaaacagggaactatgcga
tacatgagcccagaacagatttcttgtatggaggactatggaaatgaagtggacatcttt
gctctggggctaattcttgcagaacttcttcacatatgttccactgtgtcagaaacagtg
aagctttttgaagatctaagggatggcaccttctcagatgtatttgacaacaaagaaaaa
aatcttctacagaaattactctcaaatgatcccaagaaacgacctaacacattggaaata
ctgaagactttgaaggagtggaataatattgcagagaaaaagaaatggaatacatgttag

DBGET integrated database retrieval system