KEGG   Delphinapterus leucas (beluga whale): 111175000
Entry
111175000         CDS       T05885                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00230  Purine metabolism
dle01100  Metabolic pathways
dle01522  Endocrine resistance
dle04015  Rap1 signaling pathway
dle04020  Calcium signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04072  Phospholipase D signaling pathway
dle04114  Oocyte meiosis
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04261  Adrenergic signaling in cardiomyocytes
dle04270  Vascular smooth muscle contraction
dle04371  Apelin signaling pathway
dle04540  Gap junction
dle04611  Platelet activation
dle04713  Circadian entrainment
dle04714  Thermogenesis
dle04723  Retrograde endocannabinoid signaling
dle04724  Glutamatergic synapse
dle04725  Cholinergic synapse
dle04727  GABAergic synapse
dle04740  Olfactory transduction
dle04750  Inflammatory mediator regulation of TRP channels
dle04911  Insulin secretion
dle04912  GnRH signaling pathway
dle04913  Ovarian steroidogenesis
dle04914  Progesterone-mediated oocyte maturation
dle04915  Estrogen signaling pathway
dle04916  Melanogenesis
dle04918  Thyroid hormone synthesis
dle04921  Oxytocin signaling pathway
dle04923  Regulation of lipolysis in adipocytes
dle04925  Aldosterone synthesis and secretion
dle04926  Relaxin signaling pathway
dle04927  Cortisol synthesis and secretion
dle04928  Parathyroid hormone synthesis, secretion and action
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle04962  Vasopressin-regulated water reabsorption
dle04970  Salivary secretion
dle04971  Gastric acid secretion
dle04972  Pancreatic secretion
dle04976  Bile secretion
dle05032  Morphine addiction
dle05163  Human cytomegalovirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111175000 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111175000 (ADCY3)
   04371 Apelin signaling pathway
    111175000 (ADCY3)
   04020 Calcium signaling pathway
    111175000 (ADCY3)
   04072 Phospholipase D signaling pathway
    111175000 (ADCY3)
   04024 cAMP signaling pathway
    111175000 (ADCY3)
   04022 cGMP-PKG signaling pathway
    111175000 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111175000 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111175000 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111175000 (ADCY3)
   04062 Chemokine signaling pathway
    111175000 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    111175000 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    111175000 (ADCY3)
   04912 GnRH signaling pathway
    111175000 (ADCY3)
   04913 Ovarian steroidogenesis
    111175000 (ADCY3)
   04915 Estrogen signaling pathway
    111175000 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    111175000 (ADCY3)
   04921 Oxytocin signaling pathway
    111175000 (ADCY3)
   04926 Relaxin signaling pathway
    111175000 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    111175000 (ADCY3)
   04918 Thyroid hormone synthesis
    111175000 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    111175000 (ADCY3)
   04916 Melanogenesis
    111175000 (ADCY3)
   04925 Aldosterone synthesis and secretion
    111175000 (ADCY3)
   04927 Cortisol synthesis and secretion
    111175000 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111175000 (ADCY3)
   04270 Vascular smooth muscle contraction
    111175000 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    111175000 (ADCY3)
   04971 Gastric acid secretion
    111175000 (ADCY3)
   04972 Pancreatic secretion
    111175000 (ADCY3)
   04976 Bile secretion
    111175000 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111175000 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    111175000 (ADCY3)
   04727 GABAergic synapse
    111175000 (ADCY3)
   04725 Cholinergic synapse
    111175000 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    111175000 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    111175000 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    111175000 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    111175000 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    111175000 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    111175000 (ADCY3)
   04714 Thermogenesis
    111175000 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111175000 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    111175000 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    111175000 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111175000 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111175000 (ADCY3)
   05163 Human cytomegalovirus infection
    111175000 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111175000 (ADCY3)
Enzymes [BR:dle01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111175000 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 111175000
NCBI-ProteinID: XP_022430019
UniProt: A0A2Y9N5N0
LinkDB
Position
Unknown
AA seq 1150 aa
MPRTQGFSDPEYSAEYSAEYSVSLPSDPDRRVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLAVAGVGLVLDII
LFVLCRKGLLPNRVTRKVVPYLLWLLITAQVFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQRDGLKGMQLLREMLANVFLYLCAIVVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLDEKGIETYLIIASKPEVKRTAAQNGLSGSALLNGAPPSSKPGSPALIETKEPNGSIHT
SGSTSEEPDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQVV
KKRNTFFLSMRFMDREMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTNYVT
FVVGEVLLLTLTVCSLAAIFPRAFPKKIVAFSTWIDRTRWARNTWAMLAIFILVMANVVD
MLSCLQYYMGPTNGTSRVQIEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLMLLI
AGAVAVINMYAWRPIFDEYDRRRFQEHDFPMVALEKMQVLSSPGLNGTDRLPLVPSKCSM
TVMIFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVAR
HFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSL
LDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKERSDKERWQHLADLADFALAM
KDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNI
QVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGREKPATFPNGSSVTLPHQESLP
TSITLLLTLA
NT seq 3453 nt   +upstreamnt  +downstreamnt
atgccgaggacccagggcttctccgatcctgagtactcggccgagtactcagccgagtac
tccgtcagcctgccctctgaccctgaccgcagggtgggccggacccatgagatctctgtc
cggaactcgggatcctgcctgtgcctgcctcgcttcatgcggctgaccttcgtgccggag
tccttggagaacctgtaccagacctacttcaaaaggcagcgccacgagacgctgctggtg
ctggtggtattcgcggccctcttcgactgctacgtggtggtcatgtgcgcggtggtcttc
tccagtgacaagctggctcccctggctgtggccggggtcgggctggtgttggacatcatc
ctgtttgtgctctgcagaaaggggctgctgcccaaccgggtcacccggaaagtggtgccc
tacctgctgtggctgctgataacagcccaggtcttctcctacctgggcctgaacttctcc
cgcgcccatgcagccagcgacacggtgggctggcaggccttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccattgtcatcatctctgtagtctcctgcgtcgtg
cacacgctcgtcttgggggtcaccgtggcccagcagcagcgggacgggctgaaggggatg
cagttgctgagggagatgctggccaatgtcttcctctacctgtgcgccatcgttgtgggc
atcatgtcctactacatggcggaccgcaagcaccgcaaggccttcctggaggcccgccag
tcactggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctt
tccatcctgcccaagcacgtggcagacgagatgctgaaggacatgaagaaggacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccacgagaacgtcagcatc
ctctttgccgacatcgtgggcttcacccagctgtcttcagcctgcagcgcccaagagctc
gtgaagctcctcaatgagctctttgcccgcttcgacaagctggcggccaaataccaccag
ctgcggattaagattctgggcgactgttactactgcatctgtgggctgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtacgggagaagacgaagactggggtggacatgcgagtcggggtgcacacaggcaccgtg
ctggggggtgtcctgggccagaagcgctggcagtacgacgtgtggtccaccgatgtcacc
gtggccaacaagatggaggctggcggcatccccgggcgtgtgcacatctcccagagcacc
atggactgcctgaaaggcgagttcgacgtggagccaggcgatgggggcagccgctgtgat
tacctggatgagaagggcatcgaaacctacctcatcattgcgtccaagccagaggtgaag
aggacagctgcccaaaatggcctcagcggctcggctctgctgaacggagcgccaccttcc
tcaaagcccggctcccctgccctcattgagaccaaggagcccaacgggagcatccacacc
agcggctccacgtccgaggagccagatgcccaggctgacaacccctcgttccccaaccct
cgccggaggctgcggcttcaggacctggccgatcgcgtggtggacgcctccgaggacgag
cacgagctcaaccagctgctcaacgaggccctgctggagcgggagtctgcccaggtagtg
aagaagagaaataccttcttcctgtccatgcggttcatggaccgcgagatggaaacccgc
tactcggtggagaaggagaagcagagtggggccgccttcagctgttcctgcgtcgtcctg
ctctgcaccgccctggttgagattctcatcgacccctggctgatgacaaactatgtgacc
tttgtggttggcgaggtcctgctcctgaccctgaccgtctgctcgctggctgccatcttt
cctcgggcctttcctaagaagatcgtggccttctcgacttggatcgaccggacgcgctgg
gccaggaacacctgggccatgctggccatcttcattctggtcatggcaaacgtcgtggac
atgcttagctgtctccagtactacatgggacccaccaacggcacctcaagggtgcagata
gaggacggctgcgtggagaaccccaagtattacaactacgtcgctgtgctgtccctgatc
gccaccatcatgctggtgcaggtcagccacatggtcaagctgacactcatgctgctcatc
gcaggggctgtggccgtcatcaacatgtacgcctggcgccccatctttgatgaatacgac
cgcagacgcttccaggaacacgactttccgatggtggccttagagaagatgcaggtactt
tccagccctgggctcaatggcactgacaggctgcccctggtgccatccaagtgctcgatg
acggtgatgatcttcgtcatgatgctcagtttctactacttctcccgccacgtggagaag
ctggcacggacactgttcttatggaagattgaggtccacgaccagaaggaacgtgtctat
gaaatgagacgctggaacgaggccttggtcactaacatgttgcctgagcacgtggcacgc
catttcctggggtccaagaagagagacgaggagctgtacagtcagtcttatgacgagatt
ggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggagagcatcaat
aacggtggcattgagtgtctgcgcttcctcaatgagatcatctcagattttgactctctc
ctggacaatcccaagtttcgggtcatcaccaagatcaaaaccattggcagcacctacatg
gcagcttcaggagtcaccccagatgtcaacaccaatggctttaccagctccaacaaggag
aggtcagacaaggagcgctggcagcacctggcggatctggccgacttcgcactcgccatg
aaagacacgctcaccaacatcaacaaccagtccttcaataacttcatgttgcgcatcggc
atgaacaaaggaggggtactggctggcgtcatcggagcccggaaaccacactatgacatc
tggggcaatacagtcaacgtagccagcaggatggagtccacaggggtcatgggcaacatt
caggtggtggaagaaactcaagtcatccttcgagagtacggcttccgctttgtgaggaga
gggcccatctttgtgaaagggaagggggagctgctaaccttcttcttgaaggggcgagag
aagcctgccacgttccctaacggctcctcggttacactgccccaccaggaaagcctgcca
acgtcgatcacccttctactcacactagcttga

DBGET integrated database retrieval system