KEGG   Delphinapterus leucas (beluga whale): 111175081
Entry
111175081         CDS       T05885                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04110  Cell cycle
dle04218  Cellular senescence
dle04934  Cushing syndrome
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05212  Pancreatic cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05219  Bladder cancer
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111175081 (RB1)
   04218 Cellular senescence
    111175081 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111175081 (RB1)
   05203 Viral carcinogenesis
    111175081 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111175081 (RB1)
   05225 Hepatocellular carcinoma
    111175081 (RB1)
   05226 Gastric cancer
    111175081 (RB1)
   05214 Glioma
    111175081 (RB1)
   05220 Chronic myeloid leukemia
    111175081 (RB1)
   05218 Melanoma
    111175081 (RB1)
   05219 Bladder cancer
    111175081 (RB1)
   05215 Prostate cancer
    111175081 (RB1)
   05224 Breast cancer
    111175081 (RB1)
   05222 Small cell lung cancer
    111175081 (RB1)
   05223 Non-small cell lung cancer
    111175081 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111175081 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111175081 (RB1)
   05161 Hepatitis B
    111175081 (RB1)
   05160 Hepatitis C
    111175081 (RB1)
   05163 Human cytomegalovirus infection
    111175081 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111175081 (RB1)
   05169 Epstein-Barr virus infection
    111175081 (RB1)
   05165 Human papillomavirus infection
    111175081 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111175081 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111175081 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111175081 (RB1)
Protein phosphatases and associated proteins [BR:dle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111175081 (RB1)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    111175081 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1
Other DBs
NCBI-GeneID: 111175081
NCBI-ProteinID: XP_030618311
LinkDB
Position
Unknown
AA seq 894 aa
MPPKTPRRAAAAAAAAEPPPPPPPPPPEEDPEQDSGPEDLPLARLEFEETEEPDFTALCQ
KLRIPDHVRERAWLTWEKVSSVDGVLEGYVQKKKELWGICIFIAAVDLDEMPFTFTELQK
NIETSVYKFFDLLKEIDTSIKVDNVMSRLLKKYNVLCALYSKLERTCELIYLSQPSSSIS
TEINSMLVLKVSWLTFLLAKGQVLQMEDDLVISFQLMLCVLDYFIKLSPPALLKEPYKTA
VIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNS
LGIVASNGLPEQLVTYGFSHCGLSRLVHVHVIEAIYLKVEEETVMNTIQQLMMILNSASD
QPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCMEIGSQRYKLGVRLYY
RVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDTGTDLSF
PWILNVLNLKAFDFYKVIESFIKAEANLTREMIKHLERCEHRIMESLAWLSESPLFDLIK
QAKDREGPADHLEPACTLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANSEAQATS
AFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCARLLSDHPELEHIIWTLFQHTLQNEYEL
MRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKHVLIREEEYDSIIV
FYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFSSSPLRVPGGNIYISPLKNPYK
ISEGLPMPAKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKK
LRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSTDTSNREEK
NT seq 2685 nt   +upstreamnt  +downstreamnt
atgccgcccaaaaccccccgtagagcagcagccgccgccgctgccgcggagcccccgccg
cctcccccgccgcctcctcctgaggaggaccccgagcaggatagcggccccgaggacctg
cctctggccaggcttgagtttgaagaaactgaagaacctgattttactgcattatgtcag
aaattaaggataccagatcatgtcagagaaagagcttggttaacttgggagaaagtttca
tctgtggatggagtcttggaaggttatgttcaaaagaaaaaggaactatggggaatttgt
atctttattgcagcagttgacctagatgagatgccattcactttcactgagctgcagaaa
aacattgaaaccagtgtctataaattttttgacttactaaaagaaatcgataccagtatc
aaagttgataatgttatgtcaagactgttgaagaagtataatgtgttgtgtgcactctac
agcaaattagaaagaacatgtgaacttatatatttgtcacaacccagcagttcgatatct
acggaaataaattctatgttggtgctaaaagtttcttggctcacgtttttactagctaaa
gggcaagttttacaaatggaagatgatctggtgatctcatttcagttaatgctgtgtgtc
cttgactattttatcaaactctcacctcccgcattactcaaagaaccatacaaaacagct
gtaatacctattaatggttcacctcgaacaccaaggcgaggtcagaacaggagtgcacgg
atagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaagaacatgaa
tgtaatatagatgaggtgaaaaatgtttatttcaaaaattttataccttttatgaattct
cttggaattgtagcttctaacggacttccagagcagttggtcacttatggctttagtcat
tgtggcttaagtagattagtacatgtacacgtcatagaagcaatatatttaaaagttgag
gaagagactgtcatgaatactatccagcaattaatgatgatcttaaattcagcaagtgat
caaccgtcagaaaatctgatttcctattttaataattgcacagtgaatccaaaggaaagc
atcctgaaaagagtgaaggatattgggtacatctttaaagagaaatttgctaaagctgtg
ggacagggatgtatggaaattggatcacagcgatacaaacttggagtccgattgtattac
cgagtaatggaatccatgcttaaatcagaagaagaacgattatccattcaaaattttagc
aaactcctgaatgacaacatctttcatatgtctttgttggcatgcgctcttgaggttgta
atggctacatatagcagaagtacatctcagaatctggatactggaacagatttgtccttc
ccttggattctgaatgtacttaatttaaaagcttttgatttttacaaagtgattgaaagt
tttatcaaagcagaagccaacttgaccagagaaatgattaaacatttagaacgatgtgaa
catcgaatcatggaatcccttgcctggctctcagagtcacctttatttgatcttattaaa
caagcaaaggaccgagaaggaccagctgatcaccttgaacctgcttgtactctcaacctt
cctctccagaataatcacactgcagcagatatgtatctttctcctgtaagatccccaaag
aaaaaagggtcaactacacgtgtaaattctactgcaaattcagaggcacaagcaacctca
gccttccagactcagaagccattgaaatctacctccctttcactcttttacaaaaaagtg
tatcgactagcatatcttcgactaaataccctgtgtgcacgccttctgtctgaccaccca
gaactagaacatattatctggacccttttccaacacacactgcaaaatgagtatgaactc
atgagagacaggcatttggaccagattatgatgtgttccatgtatggcatatgcaaagtg
aagaatatagaccttaaattcaaaatcattgtaacagcatacaaagatcttcctcatgct
gttcaggagacattcaaacatgttttgatcagagaagaggagtatgattctattatcgta
ttctataattcagtcttcatgcagagactgaaaacaaatattttgcagtatgcttccacc
aggccccctaccttgtcaccaattcctcacattcctcgaagcccttacaagttttctagc
tcacctttacgggttcctggggggaacatctacatatcacccctgaagaatccgtataaa
atttcagaaggtctgcctatgccagcaaaaatgactccaagatcaaggatcttagtatca
attggtgaatcatttgggacttctgagaagttccagaaaataaatcaaatggtgtgtaac
agcgaccgtgtgctcaaaagaagtgctgaaggaagcaaccctcctaaaccactgaaaaaa
ctgcgctttgacattgaaggatcggatgaagcagatggaagtaaacatctcccaggggag
tccaaatttcaacagaaactggcagaaatgacatctactcgaacacgaatgcaaaagcag
aaaatgaatgatagcacggatacctcaaacagggaagaaaagtga

DBGET integrated database retrieval system